Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Stenotrophomonas maltophilia R551-3  

Data for CP001111  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001111.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001111_2181 CDS_2446438-2444852 73.2 8.9e-25 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001111_2181 1/1 323 404 .. 1 85 [] 73.2 8.9e-25

Alignments of top-scoring domains:
CP001111_2181: domain 1 of 1, from 323 to 404: score 73.2, E = 8.9e-25
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+N+++++++ia T+ + +s+de++e++ gRL++L+r+++L
CP001111_2 323 ELQHRVRNIMSTIHAIAWRTRESVGSVDEYAERLCGRLMSLARTQSL 369

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr ag+ Lr l +e+a+ ++ a +l+G+d
CP001111_2 370 --LTRGANAGVCLRGMLDEEIAAQSPP-AAVYRLQGED 404


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 7 0|=
-13 37 0|====
-12 297 0|=========================
-11 383 33|==*=============================
-10 595 417|==================================*===============
-9 696 1033|==========================================================*
-8 701 1073|==========================================================*
-7 508 720|=========================================== *
-6 312 393|========================== *
-5 199 194|================*
-4 143 92|=======*====
-3 64 42|===*==
-2 42 19|=*==
-1 25 9|*==
0 13 4|*=
1 9 1|*
2 5 0|=
3 0 0|
> 4 3 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4196.9971
P(chi-square) = 0

Total sequences searched: 4039

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: