Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
7 projects found  

4 accessions found for Deinococcus deserti VCD115  

Data for CP001114  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001114.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001114_1705 CDS_1876325-1874598 84.2 1e-24 1
CP001114_1917 CDS_2115446-2117182 83.1 2.1e-24 1
CP001114_0677 CDS_742220-745138 50.7 7.3e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001114_1705 1/1 367 434 .. 1 70 [] 84.2 1e-24
CP001114_1917 1/1 378 445 .. 1 70 [] 83.1 2.1e-24
CP001114_0677 1/1 779 843 .. 1 70 [] 50.7 7.3e-15

Alignments of top-scoring domains:
CP001114_1705: domain 1 of 1, from 367 to 434: score 84.2, E = 1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHDsv+Q+L +i+l++ +ar+ l d+dp++are ld
CP001114_1 367 ERARLARELHDSVAQALYGITLGAKTARATL--DRDPGRARESLDYT 411

relarealaevRrllgdLRpaal<-*
+la+ + +e+ +ll LRp+al
CP001114_1 412 IRLAEGGVSEMKALLFSLRPDAL 434

CP001114_1917: domain 1 of 1, from 378 to 445: score 83.1, E = 2.1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HDsv+QsL+ +l+l+ + r++ +kdp +a+++++++
CP001114_1 378 ERARIAREIHDSVAQSLAFTALKLDIVTRQM--HKDPVQAEAEVRAA 422

relarealaevRrllgdLRpaal<-*
+l+re ++evRr + +LRp +l
CP001114_1 423 SALLREQIREVRRSIFALRPIDL 445

CP001114_0677: domain 1 of 1, from 779 to 843: score 50.7, E = 7.3e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+RELHD +Q L+a + + ++ ++ +e r+++d i
CP001114_0 779 ERRRISRELHDDTAQVLTATTRRVARLS-----RELEGEQRARADDI 820

relarealaevRrllgdLRpaal<-*
+++a++ vRr +++LRp++l
CP001114_0 821 LVDLNDAIESVRRFARNLRPSVL 843


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 2 0|=
-13 16 0|==
-12 41 28|===*==
-11 88 237|=========== *
-10 256 551|================================ *
-9 423 626|===================================================== *
-8 380 482|================================================ *
-7 371 303|=====================================*=========
-6 316 171|=====================*==================
-5 276 92|===========*=======================
-4 150 48|=====*=============
-3 91 24|==*=========
-2 69 12|=*=======
-1 40 6|*====
0 28 3|*===
1 15 1|*=
2 7 0|=
3 6 0|=
4 4 0|=
5 4 0|=
6 2 0|=
> 7 8 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1668.9497
P(chi-square) = 0

Total sequences searched: 2593

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: