hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001150.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001150_0547 CDS_541656-545168 96.2 9.7e-33 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001150_0547 1/1 964 1044 .. 1 85 [] 96.2 9.7e-33
Alignments of top-scoring domains:
CP001150_0547: domain 1 of 1, from 964 to 1044: score 96.2, E = 9.7e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKN L++V ++++ +R ++++e +e++++R++AL+++H+L
CP001150_0 964 ELQHRVKNMLSNVIALVNRARREQGDPQEILETLAQRIRALANTHNL 1010
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++Wa+ +L+++ + eL g +eR+tl GP+
CP001150_0 1011 --LTSENWASTSLSDIFALELLNVYG--EERVTLRGPE 1044
Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-15 2 0|=
-14 6 0|=
-13 64 0|=======
-12 225 0|=======================
-11 244 25|==*======================
-10 402 320|===============================*=========
-9 575 793|==========================================================*
-8 561 823|========================================================= *
-7 400 553|======================================== *
-6 227 302|======================= *
-5 165 149|==============*==
-4 87 70|======*==
-3 55 32|===*==
-2 39 15|=*==
-1 13 6|*=
0 17 3|*=
1 7 1|*
2 4 0|=
3 3 0|=
4 0 0|
5 0 0|
> 6 5 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2175.4485
P(chi-square) = 0
Total sequences searched: 3101
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K