Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Rhodobacter sphaeroides KD131  

Data for CP001151  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001151.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001151_0183 CDS_190344-188149 66.6 4.9e-23 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001151_0183 1/1 540 621 .. 1 85 [] 66.6 4.9e-23

Alignments of top-scoring domains:
CP001151_0183: domain 1 of 1, from 540 to 621: score 66.6, E = 4.9e-23
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HRVKN+LA+VQ++arQT+ + ++ +++ea gRLq+L++a +
CP001151_0 540 EMEHRVKNILALVQAVARQTFGRIPEASSALEAYGGRLQSLAGAYSH 586

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++W+ A+Lr +++ ++ +g+ ae l+GP+
CP001151_0 587 --LNHESWERASLRHIVATSIGGCGAR-AEAWSLDGPE 621


Histogram of all scores:
score obs exp (one = represents 5 sequences)
----- --- ---
-14 9 0|==
-13 34 0|=======
-12 79 0|================
-11 83 10|=*===============
-10 138 126|=========================*==
-9 238 313|================================================ *
-8 203 325|========================================= *
-7 168 218|================================== *
-6 83 119|================= *
-5 84 59|===========*=====
-4 32 28|=====*=
-3 33 13|==*====
-2 15 5|*==
-1 7 2|*=
0 5 1|*
1 4 0|=
2 2 0|=
> 3 7 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 675.8602
P(chi-square) = 0

Total sequences searched: 1224

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: