Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Rhodobacter sphaeroides KD131  

Data for CP001152  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001152.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001152_0107 CDS_124088-125524 115.4 1.4e-40 1
CP001152_0076 CDS_85704-88646 87.6 4e-31 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001152_0107 1/1 290 372 .. 1 85 [] 115.4 1.4e-40
CP001152_0076 1/1 772 859 .. 1 85 [] 87.6 4e-31

Alignments of top-scoring domains:
CP001152_0107: domain 1 of 1, from 290 to 372: score 115.4, E = 1.4e-40
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+V+Si r T +++++l+ + aF++R+qAL+++H+L
CP001152_0 290 ELDHRVKNTLALVMSISRRTMHSEETLEGYQKAFTARIQALAATHNL 336

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L +W+ ++r++l +eLaPy+ ++Ri ++ Pd
CP001152_0 337 --LAAKSWSDISIRDVLVRELAPYNEGFSQRILVEVPD 372

CP001152_0076: domain 1 of 1, from 772 to 859: score 87.6, E = 4e-31
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+L+vV +ia+ Tl +a+sl++f+++F++RL AL+r+ +L
CP001152_0 772 ELQHRTRNLLTVVRAIAARTLSSAGSLADFRTRFEDRLLALARVNGL 818

VpLtr.seWagAdLreLleaeLaPygged....aeRitlsGPd<-*
L+r +e+ ++ eL++aeL+ +g +++++ ++++ l+GP+
CP001152_0 819 --LSRlEEGDRITFDELIRAELEGHGLPAddgaGPQVMLEGPR 859


Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-13 3 0|===
-12 7 0|=======
-11 12 1|*===========
-10 11 14|=========== *
-9 31 36|=============================== *
-8 26 37|========================== *
-7 22 25|====================== *
-6 11 13|=========== *
-5 5 6|=====*
-4 3 3|==*
-3 6 1|*=====
-2 1 0|=
-1 0 0|
> 0 4 -|====


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 6.8833
P(chi-square) = 0.2295

Total sequences searched: 142

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: