Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

5 accessions found for Rhizobium leguminosarum bv. trifolii WSM2304  

Data for CP001191  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001191.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001191_2145 CDS_2221483-2220407 99.4 4.6e-28 1
CP001191_0075 CDS_75154-74078 80.7 9.5e-23 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001191_2145 1/1 159 243 .. 1 94 [] 99.4 4.6e-28
CP001191_0075 1/1 162 250 .. 1 94 [] 80.7 9.5e-23

Alignments of top-scoring domains:
CP001191_2145: domain 1 of 1, from 159 to 243: score 99.4, E = 4.6e-28
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HR+ N+L ++ +L+r+Q+ +kd+ + ++aL+E+q R+ +
CP001191_2 159 EVNHRIANSLGLVGALIRMQSSMTKDQVA-----IDALHETQMRINA 200

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H++LY+++ +++v ++eYl+ L+ +L s+++++ ++ +
CP001191_2 201 IASVHRRLYTNRQVGSVQVDEYLNSLLTELEASMRDDKRPHR----V 243

CP001191_0075: domain 1 of 1, from 162 to 250: score 80.7, E = 9.5e-23
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRVKNNLQ+I++L+r++ar+++ e e + +R+ +
CP001191_0 162 ELQHRVKNNLQMITALIRMEARNAQQSEE-----SERFARLAGRIEA 203

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
Al+++ L+ e tvd++ Y++ ++++ + +++v++++++ k+D+
CP001191_0 204 LALLYRSLSDEEKGATVDLGTYVSQIAASVMAAHAVEGIRLDMKVDT 250


Histogram of all scores:
score obs exp (one = represents 20 sequences)
----- --- ---
-15 5 0|=
-14 21 0|==
-13 79 27|=*==
-12 224 284|============ *
-11 1172 791|=======================================*===================
-10 986 1023|================================================== *
-9 704 864|==================================== *
-8 490 580|========================= *
-7 248 344|============= *
-6 218 191|=========*=
-5 80 103|==== *
-4 41 54|==*
-3 22 28|=*
-2 13 14|*
-1 10 7|*
0 4 4|*
1 3 2|*
> 2 5 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 382.6859
P(chi-square) = 0

Total sequences searched: 4325

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: