Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

5 accessions found for Rhizobium leguminosarum bv. trifolii WSM2304  

Data for CP001191  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001191.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001191_2991 CDS_3085154-3086218 139.8 1.9e-47 1
CP001191_2998 CDS_3092239-3094809 118.4 3.7e-40 1
CP001191_3328 CDS_3474991-3476643 82.8 4.9e-28 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001191_2991 1/1 157 239 .. 1 85 [] 139.8 1.9e-47
CP001191_2998 1/1 522 604 .. 1 85 [] 118.4 3.7e-40
CP001191_3328 1/1 357 438 .. 1 85 [] 82.8 4.9e-28

Alignments of top-scoring domains:
CP001191_2991: domain 1 of 1, from 157 to 239: score 139.8, E = 1.9e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+LA++Q+ia+QT+Rn+ sld+f+ +F+gRLq+Ls+++dL
CP001191_2 157 ELSHRSKNLLAIIQGIATQTARNTLSLDSFLLKFRGRLQSLSNSQDL 203

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+s+W+gA L+eL+e ++aPy++e a+ + G +
CP001191_2 204 --ITDSSWRGAYLFELAEKQFAPYWPETAGSMPIYGIN 239

CP001191_2998: domain 1 of 1, from 522 to 604: score 118.4, E = 3.7e-40
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRV+N+L+++ +i+rQ+ ++ s+ ++ ++++gR q+L+raHd+
CP001191_2 522 ELNHRVRNILSLITGIIRQSQATSVSVGDYIRQIEGRVQSLARAHDQ 568

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+tr++Wa+A+Lr+Ll ae a+y g+ a+Ri++ G d
CP001191_2 569 --ITRDHWAPASLRQLLMAETAAYLGKNAQRIQIGGAD 604

CP001191_3328: domain 1 of 1, from 357 to 438: score 82.8, E = 4.9e-28
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR KN+L++ Q+++rQ +++++s++ f +a+++RL L+r+ L
CP001191_3 357 ELVHRTKNLLTLAQAMMRQLAKQTDSVETFQAAVADRLEGLGRSIEL 403

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++W+g++Lr ++ + L+++ + +e+i+++G+d
CP001191_3 404 --LTSEQWGGVSLRRVVDIHLQAFPQS-REQIEITGED 438


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-15 2 0|=
-14 10 0|=
-13 55 0|====
-12 381 0|============================
-11 474 35|==*===============================
-10 636 447|===============================*==============
-9 806 1106|==========================================================*
-8 769 1149|======================================================= *
-7 505 772|===================================== *
-6 280 421|==================== *
-5 191 208|==============*
-4 98 98|======*
-3 46 45|===*
-2 29 21|=*=
-1 21 9|*=
0 9 4|*
1 4 2|*
2 3 0|=
> 3 6 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 5888.7427
P(chi-square) = 0

Total sequences searched: 4325

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: