hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001192.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001192_0156 CDS_170081-168696 67.0 5.2e-20 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001192_0156 1/1 250 317 .. 1 70 [] 67.0 5.2e-20
Alignments of top-scoring domains:
CP001192_0156: domain 1 of 1, from 250 to 317: score 67.0, E = 5.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD+++Q+L +++ ++la r + +++ +ea+ ++++
CP001192_0 250 ERTRLARELHDGISQTLLGVRYAMDLAGRKV--RTNVDEAALTIERG 294
relarealaevRrllgdLRpaal<-*
e+++ a++e+R l +dLRp +l
CP001192_0 295 VEALNGAIKEIRLLSHDLRPRVL 317
Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-14 4 0|=
-13 16 0|====
-12 19 12|==*==
-11 48 106|============ *
-10 153 246|======================================= *
-9 226 280|========================================================= *
-8 179 216|============================================= *
-7 140 135|=================================*=
-6 116 76|==================*==========
-5 111 41|==========*=================
-4 48 21|=====*======
-3 39 11|==*=======
-2 22 5|=*====
-1 13 2|*===
0 14 1|*===
1 7 0|==
2 3 0|=
> 3 3 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 375.7286
P(chi-square) = 0
Total sequences searched: 1161
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K