Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

5 accessions found for Rhizobium leguminosarum bv. trifolii WSM2304  

Data for CP001192  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001192.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001192_0823 CDS_891188-890172 101.4 6.5e-35 1
CP001192_0824 CDS_891395-892432 95.3 7.6e-33 1
CP001192_0438 CDS_470042-471703 89.8 5.9e-31 1
CP001192_0799 CDS_867199-871173 69.5 4.8e-24 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001192_0823 1/1 142 223 .. 1 85 [] 101.4 6.5e-35
CP001192_0824 1/1 160 237 .. 1 85 [] 95.3 7.6e-33
CP001192_0438 1/1 362 441 .. 1 85 [] 89.8 5.9e-31
CP001192_0799 2/2 1117 1202 .. 1 85 [] 68.5 1e-23

Alignments of top-scoring domains:
CP001192_0823: domain 1 of 1, from 142 to 223: score 101.4, E = 6.5e-35
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KNtLAvVQ+i+ Q++R+a + e+ +++s+R+ A ++aHd+
CP001192_0 142 ELSHRIKNTLAVVQAIISQSFRSASRMVEAEQSISARINAYANAHDI 188

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W +A++ ++ea+ g e ++Ri+ sGPd
CP001192_0 189 --LLQKNWLSATMETIVEATATNLGLE-PDRIEASGPD 223

CP001192_0824: domain 1 of 1, from 160 to 237: score 95.3, E = 7.6e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN LA+V Si+r + na++ + +++a+ R qAL+raH+L
CP001192_0 160 EVDHRSKNVLAIVDSIVRLS--NADDAALYAAAIQHRVQALARAHNL 204

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++ W+ + eL++ ++ P++ a+R+ l GPd
CP001192_0 205 --LAERGWSNISVEELVRLQVTPFA---ATRVALNGPD 237

CP001192_0438: domain 1 of 1, from 362 to 441: score 89.8, E = 5.9e-31
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HRVKN +A+VQ+iarQT +++s +e aF+ RL+AL+++ dL
CP001192_0 362 EMAHRVKNGFALVQAIARQT--FSRSNPESYNAFAERLAALAGTYDL 406

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+ +e++ A +re+++a+L+++ + +eRi+l+GPd
CP001192_0 407 --ILSREGSAAPIREIISAALRAHIAS-QERIRLDGPD 441

CP001192_0799: domain 2 of 2, from 1117 to 1202: score 68.5, E = 1e-23
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N++AvV S+a TlR++++l++f+ +F++RL ++r+++
CP001192_0 1117 ELQHRTRNLMAVVRSMADKTLRTSTDLADFHKKFRDRLDVMARVQGF 1163

VpLtr.seWagAdLreLleaeLaPygged..aeRitlsGPd<-*
L+r +++ ++ +L+++eL+ +g + ++ R+ l+GPd
CP001192_0 1164 --LSRlQDGGRITFDQLIRSELSSHGVAEgeTSRVFLQGPD 1202


Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-14 1 0|=
-13 11 0|===
-12 75 0|===================
-11 110 9|==*=========================
-10 192 120|=============================*==================
-9 225 297|========================================================= *
-8 204 308|=================================================== *
-7 151 207|====================================== *
-6 82 113|===================== *
-5 54 56|=============*
-4 25 26|======*
-3 14 12|==*=
-2 7 5|=*
-1 5 2|*=
0 0 1|*
> 1 5 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 1185.3223
P(chi-square) = 0

Total sequences searched: 1161

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: