Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Oligotropha carboxidovorans OM5  

Data for CP001196  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001196.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001196_0615 CDS_615539-616615 73.4 2.3e-21 1
CP001196_3444 CDS_3446929-3449184 34.1 8.3e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001196_0615 1/1 150 217 .. 1 70 [] 73.4 2.3e-21
CP001196_3444 1/1 543 587 .. 1 52 [. 34.1 8.3e-10

Alignments of top-scoring domains:
CP001196_0615: domain 1 of 1, from 150 to 217: score 73.4, E = 2.3e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa+IARELHD++gQ+L+a+k+ l ++r +l +d+++++ +++++
CP001196_0 150 ERAHIARELHDELGQTLTAMKMDLVWLRERL--SADNGALKPRVERL 194

relarealaevRrllgdLRpaal<-*
+la+++ +++ r+++dLRp l
CP001196_0 195 VGLADRSVTDLQRIASDLRPLML 217

CP001196_3444: domain 1 of 1, from 543 to 587: score 34.1, E = 8.3e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD vg +L + ++el +++ +r+a++ i
CP001196_3 543 ERNRIARDLHDDVGARLLSGLYKTELGDTHT-------VLRDAIADI 582

relar<-*
r++++
CP001196_3 583 RTIVS 587


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-15 2 0|=
-14 35 0|===
-13 87 0|========
-12 133 41|===*========
-11 180 341|=============== *
-10 451 791|====================================== *
-9 702 898|==========================================================*
-8 516 692|=========================================== *
-7 471 435|====================================*===
-6 363 246|====================*==========
-5 340 132|==========*==================
-4 168 68|=====*========
-3 101 35|==*======
-2 73 18|=*=====
-1 36 9|*==
0 26 4|*==
1 20 2|*=
2 8 1|*
3 1 0|=
4 3 0|=
> 5 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1402.8400
P(chi-square) = 0

Total sequences searched: 3722

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: