Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for   

Data for CP001197  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_1.hmm [HisKA]
Sequence database: CP001197.Gprot.fsa
per-sequence score cutoff: >= 26.8 [TC1]
per-domain score cutoff: >= 26.8 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA
Accession: PF00512.12
Description: His Kinase A (phosphoacceptor) domain
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001197_2660 CDS_3391849-3395925 163.3 2.2e-46 2
CP001197_2670 CDS_3406530-3408245 106.3 7e-30 1
CP001197_1088 CDS_1337733-1342379 104.9 1.7e-29 3
CP001197_1239 CDS_1546455-1549760 98.5 1.1e-27 1
CP001197_2303 CDS_2929518-2926030 95.4 8.2e-27 2
CP001197_2254 CDS_2856128-2859799 91.3 1.2e-25 1
CP001197_1857 CDS_2306792-2304675 90.6 1.9e-25 1
CP001197_2461 CDS_3133971-3130756 89.7 3.4e-25 1
CP001197_1133 CDS_1401739-1398572 88.3 8.8e-25 1
CP001197_0063 CDS_82288-84084 87.5 1.5e-24 1
CP001197_0387 CDS_463176-460888 86.2 3.4e-24 1
CP001197_2961 CDS_3762159-3765845 85.9 4e-24 1
CP001197_2431 CDS_3093820-3090287 84.7 8.9e-24 1
CP001197_2114 CDS_2657498-2655462 82.6 3.6e-23 1
CP001197_1963 CDS_2451196-2454372 82.2 4.7e-23 1
CP001197_2654 CDS_3380356-3382266 80.0 1.9e-22 1
CP001197_2518 CDS_3210013-3212637 75.8 3e-21 1
CP001197_1123 CDS_1387508-1389010 75.6 3.5e-21 1
CP001197_2352 CDS_2998836-2994337 71.9 3.9e-20 1
CP001197_2182 CDS_2755557-2754115 71.2 5.9e-20 1
CP001197_0696 CDS_851454-849817 67.6 6.5e-19 1
CP001197_1348 CDS_1668274-1665536 66.0 1.8e-18 1
CP001197_0211 CDS_239751-241919 64.5 4.7e-18 1
CP001197_2579 CDS_3290469-3287629 62.1 2.4e-17 1
CP001197_2170 CDS_2735944-2733764 59.0 1.7e-16 1
CP001197_2521 CDS_3214962-3216506 59.0 1.7e-16 1
CP001197_2075 CDS_2608540-2611158 58.6 2.3e-16 1
CP001197_2754 CDS_3512891-3515362 58.5 2.4e-16 1
CP001197_0818 CDS_996542-994692 58.3 2.7e-16 1
CP001197_1684 CDS_2075047-2073272 57.4 4.9e-16 1
CP001197_1478 CDS_1830504-1833593 56.8 7.1e-16 2
CP001197_2129 CDS_2675567-2677756 54.4 3.4e-15 1
CP001197_0326 CDS_385826-387151 54.3 3.8e-15 1
CP001197_1973 CDS_2468570-2469688 54.0 4.6e-15 1
CP001197_1444 CDS_1785575-1788112 52.5 1.2e-14 1
CP001197_1081 CDS_1329166-1331772 51.9 1.8e-14 1
CP001197_1611 CDS_2003053-2004765 49.5 8.4e-14 1
CP001197_2708 CDS_3458155-3455132 47.1 4.2e-13 1
CP001197_2230 CDS_2824044-2826359 45.8 9.8e-13 1
CP001197_2516 CDS_3207324-3209369 45.0 1.6e-12 1
CP001197_2089 CDS_2626554-2628242 44.4 2.4e-12 1
CP001197_2312 CDS_2940460-2942283 43.8 3.6e-12 1
CP001197_2514 CDS_3206397-3202729 42.9 6.2e-12 1
CP001197_1211 CDS_1505650-1507710 41.9 1.2e-11 1
CP001197_1840 CDS_2272085-2275660 41.2 1.9e-11 2
CP001197_1246 CDS_1555740-1557257 40.5 2.9e-11 1
CP001197_0611 CDS_730088-732814 38.7 1e-10 1
CP001197_2525 CDS_3219640-3222225 37.7 1.9e-10 1
CP001197_2748 CDS_3507498-3505060 37.4 2.3e-10 1
CP001197_2550 CDS_3254838-3252637 37.1 2.7e-10 1
CP001197_1751 CDS_2164469-2166199 37.1 2.8e-10 1
CP001197_1231 CDS_1535248-1533044 35.7 6.7e-10 1
CP001197_1618 CDS_2011681-2013288 33.7 2.5e-09 1
CP001197_0984 CDS_1204387-1206210 33.6 2.7e-09 2
CP001197_1756 CDS_2168456-2169682 32.8 4.5e-09 1
CP001197_2655 CDS_3382609-3384705 32.1 7.3e-09 1
CP001197_1080 CDS_1326701-1329169 31.5 1.1e-08 1
CP001197_1970 CDS_2464544-2462844 31.5 1.1e-08 1
CP001197_2617 CDS_3337856-3340723 30.8 1.7e-08 1
CP001197_1713 CDS_2114641-2116164 27.4 1.5e-07 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001197_2670 1/1 181 246 .. 1 87 [] 106.3 7e-30
CP001197_1088 2/3 747 812 .. 1 87 [] 99.8 4.9e-28
CP001197_1239 1/1 694 759 .. 1 87 [] 98.5 1.1e-27
CP001197_2303 2/2 678 743 .. 1 87 [] 95.1 1e-26
CP001197_2254 1/1 672 737 .. 1 87 [] 91.3 1.2e-25
CP001197_2660 2/2 954 1019 .. 1 87 [] 91.2 1.3e-25
CP001197_1857 1/1 241 306 .. 1 87 [] 90.6 1.9e-25
CP001197_2461 1/1 641 706 .. 1 87 [] 89.7 3.4e-25
CP001197_1133 1/1 647 712 .. 1 87 [] 88.3 8.8e-25
CP001197_0063 1/1 182 247 .. 1 87 [] 87.5 1.5e-24
CP001197_0387 1/1 385 450 .. 1 87 [] 86.2 3.4e-24
CP001197_2961 1/1 588 653 .. 1 87 [] 85.9 4e-24
CP001197_2431 1/1 268 333 .. 1 87 [] 84.7 8.9e-24
CP001197_2114 1/1 366 433 .. 1 87 [] 82.6 3.6e-23
CP001197_1963 1/1 614 679 .. 1 87 [] 82.2 4.7e-23
CP001197_2654 1/1 151 216 .. 1 87 [] 80.0 1.9e-22
CP001197_2518 1/1 650 717 .. 1 87 [] 75.8 3e-21
CP001197_1123 1/1 259 327 .. 1 87 [] 75.6 3.5e-21
CP001197_2660 1/2 194 260 .. 1 87 [] 72.1 3.3e-20
CP001197_2352 1/1 1057 1129 .. 1 87 [] 71.9 3.9e-20
CP001197_2182 1/1 265 332 .. 1 87 [] 71.2 5.9e-20
CP001197_0696 1/1 305 373 .. 1 87 [] 67.6 6.5e-19
CP001197_1348 1/1 640 705 .. 1 87 [] 66.0 1.8e-18
CP001197_0211 1/1 397 463 .. 1 87 [] 64.5 4.7e-18
CP001197_2579 1/1 591 656 .. 1 87 [] 62.1 2.4e-17
CP001197_2170 1/1 458 524 .. 1 87 [] 59.0 1.7e-16
CP001197_2521 1/1 248 316 .. 1 87 [] 59.0 1.7e-16
CP001197_2075 1/1 585 650 .. 1 87 [] 58.6 2.3e-16
CP001197_2754 1/1 506 579 .. 1 87 [] 58.5 2.4e-16
CP001197_0818 1/1 375 441 .. 1 87 [] 58.3 2.7e-16
CP001197_1684 1/1 357 423 .. 1 87 [] 57.4 4.9e-16
CP001197_2129 1/1 449 515 .. 1 87 [] 54.4 3.4e-15
CP001197_0326 1/1 169 244 .. 1 87 [] 54.3 3.8e-15
CP001197_1973 1/1 143 212 .. 1 87 [] 54.0 4.6e-15
CP001197_1444 1/1 566 635 .. 1 87 [] 52.5 1.2e-14
CP001197_1081 1/1 613 703 .. 1 87 [] 51.9 1.8e-14
CP001197_1611 1/1 316 380 .. 1 87 [] 49.5 8.4e-14
CP001197_2708 1/1 636 702 .. 1 87 [] 47.1 4.2e-13
CP001197_2230 1/1 513 603 .. 1 87 [] 45.8 9.8e-13
CP001197_2516 1/1 434 502 .. 1 87 [] 45.0 1.6e-12
CP001197_2089 1/1 266 359 .. 1 87 [] 44.4 2.4e-12
CP001197_2312 1/1 333 405 .. 1 87 [] 43.8 3.6e-12
CP001197_1478 1/2 303 329 .. 1 27 [. 43.2 5.3e-12
CP001197_2514 1/1 847 912 .. 1 87 [] 42.9 6.2e-12
CP001197_1211 1/1 437 508 .. 1 87 [] 41.9 1.2e-11
CP001197_1246 1/1 269 335 .. 1 87 [] 40.5 2.9e-11
CP001197_1840 2/2 822 888 .. 1 87 [] 39.0 7.9e-11
CP001197_0611 1/1 657 747 .. 1 87 [] 38.7 1e-10
CP001197_2525 1/1 580 651 .. 1 87 [] 37.7 1.9e-10
CP001197_2748 1/1 509 599 .. 1 87 [] 37.4 2.3e-10
CP001197_2550 1/1 478 545 .. 1 87 [] 37.1 2.7e-10
CP001197_1751 1/1 346 418 .. 1 87 [] 37.1 2.8e-10
CP001197_1231 1/1 458 548 .. 1 87 [] 35.7 6.7e-10
CP001197_1618 1/1 304 362 .. 1 87 [] 33.7 2.5e-09
CP001197_1756 1/1 138 212 .. 1 87 [] 32.8 4.5e-09
CP001197_2655 1/1 420 491 .. 1 87 [] 32.1 7.3e-09
CP001197_1080 1/1 566 656 .. 1 87 [] 31.5 1.1e-08
CP001197_1970 1/1 328 402 .. 1 87 [] 31.5 1.1e-08
CP001197_2617 1/1 697 787 .. 1 87 [] 30.8 1.7e-08
CP001197_1713 1/1 291 344 .. 1 78 [. 27.4 1.5e-07

Alignments of top-scoring domains:
CP001197_2670: domain 1 of 1, from 181 to 246: score 106.3, E = 7e-30
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aksefla++sHE+RTP+++++g+++l+l+ t+l+eeq
CP001197_2 181 AKSEFLASMSHEIRTPMNGVLGMLDLALD---------TPLDEEQ-- 216

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
reyle ++++ae+ll+Lind+Ld+s+ieag
CP001197_2 217 ----------REYLEAAQNSAESLLALINDILDFSKIEAG 246

CP001197_1088: domain 2 of 3, from 747 to 812: score 99.8, E = 4.9e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+flan+sHE+RTP++aI+g+a+l+l+ tel++ q
CP001197_1 747 LKSDFLANMSHEIRTPMNAIIGMAHLALK---------TELDPRQ-- 782

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++y+++i+ ++++ll ++nd+Ld+s+ieag
CP001197_1 783 ----------ADYVRKIRASGQHLLGILNDILDFSKIEAG 812

CP001197_1239: domain 1 of 1, from 694 to 759: score 98.5, E = 1.1e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHE+RTPL++I+g+++l+ + t l++eq
CP001197_1 694 AKSEFLANMSHEIRTPLNGILGMLQLMHT---------TRLGAEQ-- 729

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++y ++++++++rl rL++d+Ldlsrie+g
CP001197_1 730 ----------ADYADIAIQSGRRLARLLSDMLDLSRIESG 759

CP001197_2303: domain 2 of 2, from 678 to 743: score 95.1, E = 1e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHE+RTPL++ +g+++lL++ t+l+eeq
CP001197_2 678 AKSEFLANMSHEIRTPLNGSLGMLQLLQT---------TTLDEEQ-- 713

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++yl +++ +a+rl +L++d+Ldlsr eag
CP001197_2 714 ----------QDYLTSAITSARRLTQLLSDVLDLSRVEAG 743

CP001197_2254: domain 1 of 1, from 672 to 737: score 91.3, E = 1.2e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+++la +sHE RTPL+a++g+a++L + t+l +eq
CP001197_2 672 AKTQLLARMSHEVRTPLNALLGMADVLDR---------TPLEPEQ-- 707

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r yl+++++++++ll+L+nd+Ld+sr+eag
CP001197_2 708 ----------RGYLDVLRNSGHSLLALLNDVLDFSRLEAG 737

CP001197_2660: domain 2 of 2, from 954 to 1019: score 91.2, E = 1.3e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks flan+sHELRTP+++++g+++lL + t+l++eq
CP001197_2 954 AKSAFLANMSHELRTPMNGVLGMLQLLDA---------TPLDPEQ-- 989

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r y+++++ ++ l rL+ dlLdl+r e+g
CP001197_2 990 ----------RGYVQVAHAAGSNLTRLLGDLLDLARVESG 1019

CP001197_1857: domain 1 of 1, from 241 to 306: score 90.6, E = 1.9e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks flan+sHE+RTPL++I+g+++lL++ + +++eq
CP001197_1 241 TKSLFLANMSHEIRTPLNGILGALQLLKA---------DLADPEQ-- 276

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ y + ++r+++rl +L+ dlLdlsr eag
CP001197_1 277 ----------AGYANLAIRSSQRLAHLLTDLLDLSRVEAG 306

CP001197_2461: domain 1 of 1, from 641 to 706: score 89.7, E = 3.4e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ksef+a +sHE RTP+++I+g+++lL+ ++ls eq
CP001197_2 641 SKSEFIAVMSHEVRTPINGIMGMLQLLRG---------SHLSGEQ-- 676

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ ++t+l +++ llr+++d+Ld+sr+eag
CP001197_2 677 ----------EDCVDTALGASRNLLRILDDILDISRMEAG 706

CP001197_1133: domain 1 of 1, from 647 to 712: score 88.3, E = 8.8e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+eflan+sHELRTPL++++g+++lL ++ls+e
CP001197_1 647 SKDEFLANMSHELRTPLNGVLGMLQLLDG---------PDLSDER-- 682

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r yl+t+ ++++ llr+i+dlLd+s ++ag
CP001197_1 683 ----------RGYLRTAVESGHALLRIIDDLLDISALGAG 712

CP001197_0063: domain 1 of 1, from 182 to 247: score 87.5, E = 1.5e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++flan+sHELRTPL++I+g++elLl+ + eq
CP001197_0 182 AKTQFLANISHELRTPLNGIIGLTELLLA---------AGPAGEQ-- 217

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e l +++++ ll+++n+lLd+s ieag
CP001197_0 218 ----------EECLGMVRQAGLDLLSIVNNLLDMSSIEAG 247

CP001197_0387: domain 1 of 1, from 385 to 450: score 86.2, E = 3.4e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks flan+sHELRTPL++++g+++l++ e e
CP001197_0 385 AKSLFLANMSHELRTPLNGLLGMLQLIKG---------NEDANER-- 420

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yl+ ++r+++rl +L+ dlLdlsrieag
CP001197_0 421 ----------DAYLDLAQRSGRRLTDLLGDLLDLSRIEAG 450

CP001197_2961: domain 1 of 1, from 588 to 653: score 85.9, E = 4e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHE+RTPL+aI+g++el l + l+ +
CP001197_2 588 AKSEFLANMSHEIRTPLNAIIGLTELSLQ---------ERLPGDV-- 623

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e l+ +l +ae ll ++ndlLdlsr eag
CP001197_2 624 ----------AENLRAALVSAEALLGIVNDLLDLSRVEAG 653

CP001197_2431: domain 1 of 1, from 268 to 333: score 84.7, E = 8.9e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aksefla++ HELRTP++a++g++++ l t+l ++q
CP001197_2 268 AKSEFLAGVTHELRTPMNAVIGMVDITLG---------TDLAPKQ-- 303

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
reyl+ ++++a++ll +n +Ld+s++eag
CP001197_2 304 ----------REYLNLVRSSARSLLGVVNGVLDFSKLEAG 333

CP001197_2114: domain 1 of 1, from 366 to 433: score 82.6, E = 3.6e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+an+sHEL+TPLt+I+gyae+Lle ++ s +q+
CP001197_2 366 IRRDFVANVSHELKTPLTSIKGYAETLLE--------APPSSRDQM- 403

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +l+til+ a+++ +++n lL l+r e+
CP001197_2 404 ----------AAFLRTILKNANHMTKMVNSLLVLARSEHK 433

CP001197_1963: domain 1 of 1, from 614 to 679: score 82.2, E = 4.7e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+eflan+sHE+RTPL++I+g+++lL++ + + r
CP001197_1 614 TKGEFLANMSHEIRTPLNGIMGMLQLLQT----------DPPKAMR- 649

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y+ + ++ +rl L+ d+Ldlsrieag
CP001197_1 650 ----------TVYVGAATQSCRRLGLLLGDILDLSRIEAG 679

CP001197_2654: domain 1 of 1, from 151 to 216: score 80.0, E = 1.9e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks fla++sHE+R+ L++I+g+++l+le ++ +eeq
CP001197_2 151 AKSAFLAGMSHEIRNSLNGILGMTDLALE---------SAEDEEQ-- 186

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ l t+l++ae ll+L+nd+Ld+sr+ea
CP001197_2 187 ----------RDHLVTVLESAETLLALLNDVLDFSRLEAR 216

CP001197_2518: domain 1 of 1, from 650 to 717: score 75.8, E = 3e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+efl +++HELRTPLt+I+g++elL +++ + eq
CP001197_2 650 MKNEFLTTAAHELRTPLTTILGFSELLVTGG-------DIPLVEQ-- 687

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+yl i ++a + ++ dlLd+srie g
CP001197_2 688 ----------RQYLGYINEQAALVSGIVADLLDISRIEMG 717

CP001197_1123: domain 1 of 1, from 259 to 327: score 75.6, E = 3.5e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++fl +++H+LR+P+++Irg++ lLl+++ ++l+++q
CP001197_1 259 VKNRFLGMAAHDLRNPINGIRGFSRLLLDGV------LGPLTDDQ-- 297

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r l t++++++ +l+L+ndlLd + ie+g
CP001197_1 298 ----------RSVLGTMHQASNEMLQLVNDLLDVTVIESG 327

CP001197_2660: domain 1 of 2, from 194 to 260: score 72.1, E = 3.3e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++f+an+sHELRTPLt ++g +e Ll+ +t ++e+
CP001197_2 194 LKTRFFANISHELRTPLTLLLGPLERLLA--------ETSEDDEH-- 230

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r l t+lr a+ l + ++d+Ldlsr +ag
CP001197_2 231 ----------RHSLFTMLRNARLLHQHVDDMLDLSRVDAG 260

CP001197_2352: domain 1 of 1, from 1057 to 1129: score 71.9, E = 3.9e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f+an+sHE+RTPL++I+g ++++l +l+ dt+l++ ++
CP001197_2 1057 LKSQFVANISHEMRTPLSGILGIVDVALSRLN-----DTALPAHDN- 1097

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e yl+ i++ +e ll+ indlLd+sr+eag
CP001197_2 1098 --------EQGHYLSMIRNVSEGLLHVINDLLDFSRMEAG 1129

CP001197_2182: domain 1 of 1, from 265 to 332: score 71.2, E = 5.9e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ +a+++HE+R+PL Ir aelLl+ ++ s++ +
CP001197_2 265 GMGRVVASIAHEIRNPLGIIRSSAELLLK--------RPSSSDPVT- 302

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l+ i++ea+rl++ +nd+Ld++r +++
CP001197_2 303 ----------ARILQAIYDEAKRLSQTVNDFLDYARPRQP 332

CP001197_0696: domain 1 of 1, from 305 to 373: score 67.6, E = 6.5e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ f+a+++HEL++P++ +++ ae L+e++ ++ +++
CP001197_0 305 ALGTFTAGIAHELNNPINNVLLSAEGLREDYG------EAIDADG-- 343

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e++ i ++aer ++++++lLd+sr e++
CP001197_0 344 ----------QEMIGDIMQQAERASDIVRNLLDFSRTEHP 373

CP001197_1348: domain 1 of 1, from 640 to 705: score 66.0, E = 1.8e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++a+l+HE+++PL +I+ yaelL++ + +++q
CP001197_1 640 TVGKLAAGLAHEINNPLGVILCYAELLRR---------NTGDAQQ-- 675

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l++ilr +++ +r ++dlL ++r a
CP001197_1 676 ----------QADLDVILRHTRQAQRVLRDLLNFARPKAA 705

CP001197_0211: domain 1 of 1, from 397 to 463: score 64.5, E = 4.7e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++a+++HE+R+PL+a+rg+a+ ++l + + +++
CP001197_0 397 AVGTLAAGVAHEIRNPLSALRGFAQYFAKKL-------AGKQPDE-- 434

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y +t+ rea+rl+r i dlL l+r +a
CP001197_0 435 -----------NYAQTMVREADRLNRVITDLLYLARPRAI 463

CP001197_2579: domain 1 of 1, from 591 to 656: score 62.1, E = 2.4e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++a+l+HE+++PL +I ya+lL++ ++++ q+
CP001197_2 591 AVGKLAAGLAHEINNPLGVIHCYADLLRA----------AAPDGQA- 626

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++i r +e+ ++ ++dlLd++r +
CP001197_2 627 ----------QADIDVIMRHTEQARKVVRDLLDFARPKQA 656

CP001197_2170: domain 1 of 1, from 458 to 524: score 59.0, E = 1.7e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++ +++HE++TPL I+gya+lL+e + + q+
CP001197_2 458 SVGKLAGGVAHEINTPLGIILGYAQLLQE---------DVPPGAQM- 494

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l++i+++a+ ++++++dlL +sr +
CP001197_2 495 ----------HQDLQIIEKQAKFCRKIVSDLLGFSRQTQS 524

CP001197_2521: domain 1 of 1, from 248 to 316: score 59.0, E = 1.7e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++fla +sHE+RTPL++I+g+ ++Ll+e+ +++ ++
CP001197_2 248 LKQDFLAIISHEMRTPLNGILGLGDVLLDEA-------RRRGDSDA- 286

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+l +l++a+r+ ++++++ ++ + g
CP001197_2 287 ----------EELLGHLLQAARRMHAMVREVVRFAEVQGG 316

CP001197_2075: domain 1 of 1, from 585 to 650: score 58.6, E = 2.3e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++a+l+HE+++PL +I ya+lL++ t ++++
CP001197_2 585 ALGQLAAGLAHEINNPLGVINCYAQLLQK---------TQKDPQA-- 620

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e le+i + ++ + ++dlL l+r+
CP001197_2 621 ----------QEDLEVIVQHTQKARLVLQDLLGLARANRT 650

CP001197_2754: domain 1 of 1, from 506 to 579: score 58.5, E = 2.4e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++e++a+++HE+++P+t+I+ a+lLl+++d v+a+ + + e+q
CP001197_2 506 ALGELAAGVAHEINNPITGIINCAQLLLDDAD-VSAQGGMRHEPQ-- 549

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+ +ilre++r+ ++++lL + r +
CP001197_2 550 ----------PELAGRILREGQRIAGIVRNLLFFGRDRRD 579

CP001197_0818: domain 1 of 1, from 375 to 441: score 58.3, E = 2.7e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ ++a+++HE+R+PL++I+g+a L +++ +
CP001197_0 375 ALGNLAAGVAHEIRNPLSSIKGFATYLAG---------RLQDDGKG- 411

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++ + + +e++rl+r +++lL+++r + +
CP001197_0 412 ----------RDAARLVVQEVDRLNRVVSELLEFARPGVP 441

CP001197_1684: domain 1 of 1, from 357 to 423: score 57.4, E = 4.9e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e+ +++HE+R+PL aI g+a Ll+ ++ l+e
CP001197_1 357 AIGELSTYVAHEIRNPLFAIGGFANSLLR--------SPSLDEAA-- 393

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +++il+e++rl+ ++ +L ++r ++
CP001197_1 394 ----------RGKVQVILEESRRLDTILKSILNFARPTSP 423

CP001197_2129: domain 1 of 1, from 449 to 515: score 54.4, E = 3.4e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++a+++HELR+PL++I+gya ++ + ++e+
CP001197_2 449 AIGSLAAGVAHELRNPLSSIKGYATYFGSRF--------DEGSED-- 485

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+ +++ +e+erl+r i+dl l+r
CP001197_2 486 ----------REAARVMVQEVERLNRVISDLIGLARPSDI 515

CP001197_0326: domain 1 of 1, from 169 to 244: score 54.3, E = 3.8e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
+ ++a+++HE ++PLtaI g+ae +l+++++++ d+e+ ++
CP001197_0 169 TVGMLAAGVAHEVNNPLTAIHGFAEGILRRVERLrGIVDPEMHADL- 214

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++y til e r+++++ lL++sr +
CP001197_0 215 -----------ADYAGTILGECGRCQEIVHSLLTFSRPHSS 244

CP001197_1973: domain 1 of 1, from 143 to 212: score 54.0, E = 4.6e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++a+++H +R+PLt++++ + +L++ +++ ++ eq
CP001197_1 143 LVGKLAAGVAHSIRNPLTSVKLRLFALER-----SLKLGPDQKEQ-- 182

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e +e+i e+++l++++ ++L++sr
CP001197_1 183 ----------QEDFEVIAAEIRHLDAIVTNFLEFSRRPRL 212

CP001197_1444: domain 1 of 1, from 566 to 635: score 52.5, E = 1.2e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e ++ ++HE+++PLt I++ a+ L++++ ++ +++
CP001197_1 566 AWREVARRIAHEIKNPLTPIKLSAQRLERKFA------GAVGDPV-- 604

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + ++ i r++e+l+++++++ ++++ +
CP001197_1 605 ---------FGQCTDLIVRQVEHLQQMVEEFSAFAKLPEV 635

CP001197_1081: domain 1 of 1, from 613 to 703: score 51.9, E = 1.8e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldk......vlagdtel
+ ++a+++HE+++PL +I+ +++ ++++++ +++ ++++a+++ l
CP001197_1 613 TVGGLAAGMAHEINNPLGGILQAVQNMRRRVETgrpvndTAAREAGL 659

seeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ eq++++L e +e+ ++l+ i ++ r +++ ++Ld+sr g
CP001197_1 660 TMEQVRGYL--ERREILRMLDDIAASGARAAHIVANMLDFSRRTDG 703

CP001197_1611: domain 1 of 1, from 316 to 380: score 49.5, E = 8.4e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++l ++sHE+R PL+ +++++e++ + + s+e
CP001197_1 316 TQRRLLHDVSHEMRSPLSRVSLALEMASR----------TVSPES-- 350

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++le+i+r+aerl+ L lL ++++
CP001197_1 351 ----------QRFLERIRRDAERLSTLSAHLLATGHLDQQ 380

CP001197_2708: domain 1 of 1, from 636 to 702: score 47.1, E = 4.2e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H++++ L +++gy+e+ l+ te ++ q
CP001197_2 636 AIGTLAGGIAHDFNNILGVMMGYTEMSLD--------QTEEGDAQ-- 672

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l +l +++r ++Li+++L++sr e++
CP001197_2 673 ----------HRRLTEVLAAGRRARDLIRQILTFSRQEEP 702

CP001197_2230: domain 1 of 1, from 513 to 603: score 45.8, E = 9.8e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldk.....v.lagdtel
+ + ++a+++HE+++PL +I+ a+ ++++ld + ++v +a+++ +
CP001197_2 513 SVGGLAAGMAHEINNPLGGILQGAQNIQRRLDPdfapnVvAAEESGC 559

seeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
s + ++++L +++ ++le i+++++r ++++++L++sr +
CP001197_2 560 SMDSIRGYL--DRRGILRFLEGIRESGNRAANIVSNMLEFSRRSES 603

CP001197_2516: domain 1 of 1, from 434 to 502: score 45.0, E = 1.6e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++f+ +sH+L PL I +++lL +++ + l+++
CP001197_2 434 ELEQFAYIASHDLQEPLRKIASFLDLLAKRY------VGRLDSDA-- 472

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e++ + ++a+r+ ++i+dlL +sr ++
CP001197_2 473 ----------DEFIGFAVDAARRMKDMIEDLLAYSRVSTQ 502

CP001197_2089: domain 1 of 1, from 266 to 359: score 44.4, E = 2.4e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldk..............
+++ ++++++H+L++PL+ I++ +++L+eel + +++++ ++++++
CP001197_2 266 SLGVLTSGIAHQLNNPLNNISTSCQILREEL-Ryatggngvdggpgq 311

....v.lagdtelseeqrlpeLRledpeyreyletilreaerllrLindl
++++ +++g ++l++ + ++le i++e++r ++++ l
CP001197_2 312 tggsGgAGGTGALDSALA-----------GRMLENIHQEVHRSRDIVKGL 350

Ldlsrieag<-*
L++sr +
CP001197_2 351 LEFSRETEF 359

CP001197_2312: domain 1 of 1, from 333 to 405: score 43.8, E = 3.6e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++e++a+++HE+++P++ ++ a +++ l +el e+++
CP001197_2 333 ALGEMAAGIAHEINNPVAIMMEEAGWIEDVL-------GELQEQDA- 371

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++e+ + + i+ ++ r++++ lL ++r
CP001197_2 372 ------VREIGDSARQIRTQGVRCRDITHKLLSFARRSDR 405

CP001197_1478: domain 1 of 2, from 303 to 329: score 43.2, E = 5.3e-12
*->akseflanlsHELRTPLtaIrgyaelL<-*
+ks flan+sH++RTPLt+I+g+aelL
CP001197_1 303 MKSAFLANMSHDMRTPLTGIIGMAELL 329

CP001197_2514: domain 1 of 1, from 847 to 912: score 42.9, E = 6.2e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H++++ L +I+ ++e+L++ t l+
CP001197_2 847 AVGTLAGGIAHDFNNILGVIMSNIEMLRD---------TGLTGRA-- 882

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++ilr+a r ++ +++lL + r +
CP001197_2 883 ----------ATRADRILRAALRARDVVRQLLAFGRPADE 912

CP001197_1211: domain 1 of 1, from 437 to 508: score 41.9, E = 1.2e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++e+ a+++HEL++PL+aIr+ ++ L +++ l+ +q
CP001197_1 437 SLGEMSAGVAHELNQPLNAIRMGSDFLSL------VIEQGLPVPQ-- 475

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+L +e + i +++r ++in l+ + r
CP001197_1 476 SRL-------HEVARDICTQVDRATEIINTLRSFGRKADT 508

CP001197_1246: domain 1 of 1, from 269 to 335: score 40.5, E = 2.9e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++++++HE+++PL ++++ L + + ++e+ r
CP001197_1 269 SIGQLASGVAHEINNPLGGVILCFRNLTA---------GGMDEDAR- 305

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ ++i++ +e ++r++ +l+ ++r
CP001197_1 306 ----------RQHEKVIDDGLEKIRRIVGELMHYARPSPL 335

CP001197_1840: domain 2 of 2, from 822 to 888: score 39.0, E = 7.9e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ ++sH++++ Lt+I+ +el+ d ++++ +
CP001197_1 822 AIGTLAGGISHDFNNILTSIINSIELAIS--------DIAADSLT-- 858

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l ++l++a+r +rL+ ++L++sr +
CP001197_1 859 ----------CNDLMRALKAAQRGSRLVKQILTFSRPSVE 888

CP001197_0611: domain 1 of 1, from 657 to 747: score 38.7, E = 1e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+++PL +I+ ++ L+++l + + r+
CP001197_0 657 SVGGLAAGMAHEINNPLGGILQGVQNLRRRL-------LDDLPANRA 696

peLR..l.........edpeyreyletilreaerllrLindlLdlsriea
+ R++ + ++ e + + +l+ i++++er r++ ++L++sr
CP001197_0 697 AAERqgMdfdriaayaEERRIGGLLDGIRESGERATRIVANMLTFSRRSD 746

g<-*
+
CP001197_0 747 P 747

CP001197_2525: domain 1 of 1, from 580 to 651: score 37.7, E = 1.9e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e++ +++HEL++PLt+I+++ Ll+++ + ++ ++e +
CP001197_2 580 TLGEMATGVAHELNQPLTVIKTAGGFLLRKVT----RGEPIDPEIL- 621

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + + i+ ++r +r+i ++d+ r
CP001197_2 622 ----------ATMAREIDGHVDRASRIIGHMRDFGRRSDL 651

CP001197_2748: domain 1 of 1, from 509 to 599: score 37.4, E = 2.3e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+++PL aI+ a+ ++++l + l++ +++
CP001197_2 509 SVGGLAAGMAHEINNPLGAILQGAQNIQRRLA------DGLPANEQA 549

peLRl...........edpeyreyletilreaerllrLindlLdlsriea
e Rl+ + + + e + + e+l++i++++ r ++i ++L++sr
CP001197_2 550 AE-RLgcslpviraylEERRVLEFLDSIREAGCRAANIITNMLEFSRNSG 598

g<-*

CP001197_2 599 A 599

CP001197_2550: domain 1 of 1, from 478 to 545: score 37.1, E = 2.7e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+se++ +sHEL+TP+ ++ ++a+lL + + ++l++e
CP001197_2 478 LRSEMMDWVSHELKTPMQSLCLAADLLDR-------RKDTLDAEG-- 515

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r ++et++++a rl+ L ++++d++r+
CP001197_2 516 ----------RLLVETVYEDAARLRTLAQQFMDIARMTPS 545

CP001197_1751: domain 1 of 1, from 346 to 418: score 37.1, E = 2.8e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++a+++HE+++PL+ I a l+ + ++ + +e +r
CP001197_1 346 SIGRLAAGVAHEINNPLAIINEKAGLASDLME----LAKDFPERDR- 387

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+r +++ ilr++er++++ +lL +sr
CP001197_1 388 ---------FRGLVDAILRSVERCRSITHRLLGFSRRMDV 418

CP001197_1231: domain 1 of 1, from 458 to 548: score 35.7, E = 6.7e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldk.....v.lagdtel
+ + +a+++HE+++PL aI+ +++ ++ +++ + + +a++ l
CP001197_1 458 SVGGIAAGIAHEINNPLGAIMQASQNMQQRMNTvlpanIaAAQEVGL 504

seeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + ++ +L + + +++e i+ ++ r +++i+ +Ld+sr a
CP001197_1 505 DLDALQRYL--QIRKVDRFIEDIRAAGIRASAIIRHMLDFSRGSAA 548

CP001197_1618: domain 1 of 1, from 304 to 362: score 33.7, E = 2.5e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ la++sH+LRTP+t +r+ a+ +
CP001197_1 304 ERGRVLAAISHDLRTPVTRMRLRADQVEP------------------ 332

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+ e+ l +++ +++L++ d+ r
CP001197_1 333 ----------PELRERFLTDLDEIRDLLSTTIDFVRSTDS 362

CP001197_1756: domain 1 of 1, from 138 to 212: score 32.8, E = 4.5e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++ +++HE+++P++ + +a +++ l+ +++l + ++
CP001197_1 138 SIGRLAEGVAHEINNPVNIMTNAAGWIED-----LLDEPDLASSPHA 179

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e r+ + +i+ +++r +++ + lL + + +
CP001197_1 180 AEM-------RRSVVKIKAQSRRVREITRKLLFFGKGLDP 212

CP001197_2655: domain 1 of 1, from 420 to 491: score 32.1, E = 7.3e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ ++ +++HE+++PL+a+++ya L++ la+ + +++ ++l
CP001197_2 420 AMGTLATGIAHEINQPLSALQLYAGSLEM-----LAEKDRAPDRETL 461

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+ il e+ r++++i+ ++ l +
CP001197_2 462 ----------LARLSLILGETARIRDIIDHMRALVAHGDT 491

CP001197_1080: domain 1 of 1, from 566 to 656: score 31.5, E = 1.1e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldk........v.lagd
+ + ++a+++HE+++PL +I+ +++ l+ + ++++ + ++a+
CP001197_1 566 SVGGLAAGMAHEINNPLGGILQAVQNVLR---RiepgraanDeAARA 609

telseeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<
++ eq++++L e +++ ++ +++++ r r++ ++L +sr +
CP001197_1 610 MGCTVEQVRDYL--ERRGVLRMAAGVREAGMRAARIVANMLNFSRRSTS 656

-*

CP001197_1 - -

CP001197_1970: domain 1 of 1, from 328 to 402: score 31.5, E = 1.1e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++a+++HE ++PL Ir +a +++ lsee+++
CP001197_1 328 ALGKLAAGVAHEVNNPLMLIRENAGWIRD----------LLSEEDAA 364

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ e++e+ +i++ ++r + ++L + r ++
CP001197_1 365 RMG--HHAEIEEAAVKIEQHVDRAKGITHRMLGFGRRMEP 402

CP001197_2617: domain 1 of 1, from 697 to 787: score 30.8, E = 1.7e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++ +++HEL++PL a++ ++ + ++ld d +++++ ++
CP001197_2 697 SVGGLAGGMAHELNNPLGAVLQGVQNIIRRLD----PDMAANAQAAR 739

peLR.l.......edpeyreyletilreaerllrLindlLdlsrieag<-
+++ +l ++ e + + e+le i++++ r ++i +L+++r ++g
CP001197_2 740 DAGVsLvamrsymEARRISEMLEGIRDAGVRAADIIATMLEFTRPGQG 787

*

CP001197_2 - -

CP001197_1713: domain 1 of 1, from 291 to 344: score 27.4, E = 1.5e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ ++ ++HE+R+P+ a+ g+a +L + + ++ q
CP001197_1 291 TLGALVDEIAHEFRNPVFALAGFARTLHR----------KFPDAQE- 326

peLRledpeyreyletilreaerllrLindl<-*
e++l+ea rl++Lin++
CP001197_1 327 -------------AEVVLEEATRLEALINRV 344


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-15 1 0|=
-14 7 0|=
-13 40 2|*===
-12 124 72|=======*=====
-11 266 376|=========================== *
-10 508 699|=================================================== *
-9 586 722|==========================================================*
-8 530 540|=====================================================*
-7 427 340|=================================*=========
-6 259 196|===================*======
-5 183 107|==========*========
-4 81 57|=====*===
-3 44 30|==*==
-2 21 15|=*=
-1 20 8|*=
0 11 4|*=
1 1 2|*
2 2 1|*
3 1 0|=
4 1 0|=
5 2 0|=
> 6 65 -|=======


% Statistical details of theoretical EVD fit:
mu = -8.9758
lambda = 0.6525
chi-sq statistic = 275.4896
P(chi-square) = 0

Total sequences searched: 3180

Whole sequence top hits:
tophits_s report:
Total hits: 60
Satisfying E cutoff: 60
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 60
Satisfying E cutoff: 60
Total memory: 45K


Acknowledgements:

This research is funded by:

Developed by: