Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for Desulfovibrio vulgaris str. 'Miyazaki F'  

Data for CP001197  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001197.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001197_1405 CDS_1736980-1735325 126.5 6.4e-36 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001197_1405 1/1 317 403 .. 1 94 [] 126.5 6.4e-36

Alignments of top-scoring domains:
CP001197_1405: domain 1 of 1, from 317 to 403: score 126.5, E = 6.4e-36
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+I SLL+LQa ++++ + +e + Es+nRV+S
CP001197_1 317 EVHHRVKNNLQLIVSLLNLQAAYADGAAD-----RERFIESRNRVAS 358

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl HEeLY+ dl +v++++Y+e+L++ L q ++v+++ ++L lDl
CP001197_1 359 MALAHEELYRANDLASVNVADYVERLARKLAQ-ASVDAE-VELALDL 403


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-14 18 0|==
-13 51 19|=*==
-12 170 208|============= *
-11 817 581|=========================================*=================
-10 768 752|=====================================================*=
-9 492 635|==================================== *
-8 398 426|============================= *
-7 190 253|============== *
-6 148 141|==========*
-5 61 76|=====*
-4 32 40|==*
-3 17 21|=*
-2 8 11|*
-1 3 5|*
0 3 2|*
1 0 1|*
2 1 0|=
> 3 3 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 208.1714
P(chi-square) = 1.495e-38

Total sequences searched: 3180

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: