hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001197.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001197_1594 CDS_1981884-1980187 63.7 1.4e-18 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001197_1594 1/1 319 385 .. 2 70 .] 63.7 1.4e-18
Alignments of top-scoring domains:
CP001197_1594: domain 1 of 1, from 319 to 385: score 63.7, E = 1.4e-18
*->RaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeir
R+RI+RE HD++gQ+L+a+k +l+++ r++ ++ +++ re+l +
CP001197_1 319 RRRISREVHDELGQNLTALKFGLHRLGRVV--PEGDGPSRERLLSMT 363
elarealaevRrllgdLRpaal<-*
+l +++++ vRr+ ++LRp+ l
CP001197_1 364 RLTEDTIEAVRRISRELRPGHL 385
Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 8 0|=
-13 35 0|====
-12 47 35|===*==
-11 113 291|============= *
-10 316 676|==================================== *
-9 508 767|========================================================= *
-8 439 591|================================================= *
-7 413 372|=========================================*====
-6 381 210|=======================*===================
-5 366 112|============*============================
-4 191 58|======*===============
-3 137 30|===*============
-2 75 15|=*=======
-1 61 7|*======
0 36 4|*===
1 23 2|*==
2 8 1|*
3 7 0|=
4 1 0|=
5 6 0|=
6 2 0|=
7 4 0|=
8 0 0|
9 1 0|=
10 0 0|
> 11 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2398.5208
P(chi-square) = 0
Total sequences searched: 3180
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K