Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Methylocella silvestris BL2  

Data for CP001280  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001280.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001280_1047 CDS_1151737-1150661 109.0 7.7e-31 1
CP001280_3585 CDS_4049321-4047192 76.9 1e-21 1
CP001280_0578 CDS_640259-639156 54.2 2.9e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001280_1047 1/1 156 242 .. 1 94 [] 109.0 7.7e-31
CP001280_3585 1/1 519 589 .. 1 76 [. 76.9 1e-21
CP001280_0578 1/1 161 249 .. 1 94 [] 54.2 2.9e-15

Alignments of top-scoring domains:
CP001280_1047: domain 1 of 1, from 156 to 242: score 109.0, E = 7.7e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRV N+LQ+I+S+L L ar +++ee+ + +Lr++++RV+S
CP001280_1 156 EMEHRVANSLQMIASILLLKARAVTSEET-----RVHLRDAHQRVMS 197

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A ++++L+ s ++ +++s+Yl+ L+++L s+ +s+ i +k +
CP001280_1 198 IAAVQKHLHASSGVREIEVSSYLSTLCSSLAASMVADSQPIAIK--V 242

CP001280_3585: domain 1 of 1, from 519 to 589: score 76.9, E = 1e-21
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+LQ++SS L LQ +++d + + E+ +R+ +
CP001280_3 519 EVNHRVQNSLQLVSSFLTLQGMQSQDANL-----RGSIDEANRRIGA 560

mAliHEeLYksedldtvdfseYlekLten<-*
+Al+H++LY+++ ++ v++s Y+e+L+++
CP001280_3 561 VALLHRRLYRGDQIEIVELSRYFEELVAD 589

CP001280_0578: domain 1 of 1, from 161 to 249: score 54.2, E = 2.9e-15
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI+HRV+NNLQ+I++L+r +ar + d ++ + + +R+ +
CP001280_0 161 EIQHRVRNNLQMIAALIRYEARIAGDSAA-----RGPFDKIAGRIEA 202

mAliHEeLYkse.....dldtvdfseYlekLtenLfqsygvgsdgisLkl
+ LY+s ++ + vd+++Yl+ ++++ +++++++++ ++Lk+
CP001280_0 203 L----QLLYRSMaddalG-QEVDLGSYLSQIASHVMRAHAREGITLDLKV 247

Dl<-*
D
CP001280_0 248 DA 249


Histogram of all scores:
score obs exp (one = represents 19 sequences)
----- --- ---
-15 14 0|=
-14 24 0|==
-13 78 23|=*===
-12 207 250|=========== *
-11 1092 698|====================================*=====================
-10 837 903|============================================= *
-9 617 763|================================= *
-8 413 512|====================== *
-7 206 304|=========== *
-6 174 169|========*=
-5 68 91|====*
-4 39 48|==*
-3 25 25|=*
-2 6 13|*
-1 9 6|*
0 2 3|*
1 2 1|*
> 2 5 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 448.2177
P(chi-square) = 0

Total sequences searched: 3818

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: