Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Methylocella silvestris BL2  

Data for CP001280  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001280.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001280_0214 CDS_244540-241937 107.2 2.1e-36 1
CP001280_1370 CDS_1502035-1500581 99.2 1.2e-33 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001280_0214 1/1 516 598 .. 1 85 [] 107.2 2.1e-36
CP001280_1370 1/1 294 376 .. 1 85 [] 99.2 1.2e-33

Alignments of top-scoring domains:
CP001280_0214: domain 1 of 1, from 516 to 598: score 107.2, E = 2.1e-36
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+L+v+ Si rQ+++++ s+d+fv++Fs+RL+AL+ +HdL
CP001280_0 516 ELSHRSKNLLSVIESILRQSAKGSVSKDDFVARFSDRLRALAHSHDL 562

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++ ++++ +L+ +++++++ ++++Ri lsG
CP001280_0 563 --LAKTNSLSVSMTDLIFSQVGHHWEPGQRRIMLSGLG 598

CP001280_1370: domain 1 of 1, from 294 to 376: score 99.2, E = 1.2e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+NtLA+VQ++++ T++++a+++ef eaF+gR+ +L+ +H +
CP001280_1 294 ELHHRVRNTLATVQGVMNTTAKSSATIEEFQEAFAGRIGSLAKTHAV 340

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t++ + +++ Ll +eL+ y+g+++ R++l GP+
CP001280_1 341 --MTDELDQCVSFEHLLIQELGLYAGNGRNRVHLKGPP 376


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 6 0|=
-13 49 0|====
-12 254 0|====================
-11 344 31|==*========================
-10 544 394|==============================*===========
-9 683 977|===================================================== *
-8 722 1014|======================================================== *
-7 458 681|==================================== *
-6 309 371|======================== *
-5 180 184|==============*
-4 108 87|======*==
-3 74 40|===*==
-2 44 18|=*==
-1 18 8|*=
0 14 3|*=
1 3 1|*
2 3 0|=
3 1 0|=
> 4 4 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 3526.4482
P(chi-square) = 0

Total sequences searched: 3818

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: