Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
39 projects found  

7 accessions found for Cyanothece sp. PCC 7424  

Data for CP001291  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001291.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001291_1090 CDS_1216605-1218776 156.6 2.9e-44 1
CP001291_4452 CDS_5044400-5046715 149.1 4.1e-42 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001291_1090 1/1 526 610 .. 1 94 [] 156.6 2.9e-44
CP001291_4452 1/1 576 662 .. 1 94 [] 149.1 4.1e-42

Alignments of top-scoring domains:
CP001291_1090: domain 1 of 1, from 526 to 610: score 156.6, E = 2.9e-44
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISS+LrLQ++++kde++ l ++++sqnR++S
CP001291_1 526 EIHHRVKNNLQVISSILRLQSDYVKDENI-----LRLFKDSQNRIRS 567

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE+LY+s+dl +++f++Y+++L +nL++sy s ++ l
CP001291_1 568 IALVHEKLYQSKDLLNINFDDYIRELMSNLKNSYPSNSPLVK----L 610

CP001291_4452: domain 1 of 1, from 576 to 662: score 149.1, E = 4.1e-42
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvISSL +LQ+++++d ++ l +L++sqnR+ S
CP001291_4 576 EVHHRVKNNLQVISSLFSLQSQYIEDSNI-----LSILEDSQNRISS 617

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+se+l ++df++Y++ L+++L+ sy+ + i+L+ l
CP001291_4 618 MALIHEKLYQSENLAKIDFKDYIQTLVKYLLTSYNINPQLIHLD--L 662


Histogram of all scores:
score obs exp (one = represents 22 sequences)
----- --- ---
-15 15 0|=
-14 29 0|==
-13 85 32|=*==
-12 306 343|============== *
-11 1281 955|===========================================*===============
-10 982 1237|============================================= *
-9 962 1044|============================================ *
-8 600 700|============================ *
-7 361 416|================= *
-6 316 231|==========*====
-5 119 124|=====*
-4 66 66|==*
-3 42 34|=*
-2 28 18|*=
-1 16 9|*
0 9 4|*
1 3 2|*
2 1 1|*
3 0 0|
4 2 0|=
5 0 0|
> 6 4 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 321.4182
P(chi-square) = 0

Total sequences searched: 5227

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: