Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Methylobacterium chloromethanicum CM4  

Data for CP001298  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001298.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001298_4255 CDS_4707718-4710345 113.3 6.2e-32 1
CP001298_5148 CDS_5745939-5744893 109.2 8.8e-31 1
CP001298_0479 CDS_512191-510941 103.5 3.7e-29 1
CP001298_4781 CDS_5331133-5329988 102.8 6e-29 1
CP001298_4213 CDS_4663440-4662340 90.6 1.8e-25 1
CP001298_0436 CDS_458771-457692 69.7 1.5e-19 1
CP001298_4359 CDS_4821911-4822966 68.6 3.2e-19 1
CP001298_3454 CDS_3798899-3797835 40.9 2.3e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001298_4255 1/1 685 768 .. 1 94 [] 113.3 6.2e-32
CP001298_5148 1/1 156 242 .. 1 94 [] 109.2 8.8e-31
CP001298_0479 1/1 219 304 .. 1 94 [] 103.5 3.7e-29
CP001298_4781 1/1 191 272 .. 1 94 [] 102.8 6e-29
CP001298_4213 1/1 172 258 .. 1 94 [] 90.6 1.8e-25
CP001298_0436 1/1 157 240 .. 1 94 [] 69.7 1.5e-19
CP001298_4359 1/1 155 237 .. 1 94 [] 68.6 3.2e-19
CP001298_3454 1/1 163 211 .. 1 54 [. 40.9 2.3e-11

Alignments of top-scoring domains:
CP001298_4255: domain 1 of 1, from 685 to 768: score 113.3, E = 6.2e-32
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HRVKN+LQ++++ L +Q r++ d+e+ + a+ E+ RV+S
CP001298_4 685 EIDHRVKNSLQIVTAFLHMQRRQIADPEA-----RQAFSETSARVMS 726

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H+ LY++e++++vd+++ ++ L+++L +g++ + ++ l
CP001298_4 727 VARVHDSLYQGESMEQVDLGQTIQTLCSDLAGMAGDEHS---VE--L 768

CP001298_5148: domain 1 of 1, from 156 to 242: score 109.2, E = 8.8e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+L ++++L r+Q+ ++d+++ ++aL+E q R+ +
CP001298_5 156 EVNHRVANSLTLVAALARMQTNAVTDPAA-----KDALEEMQARISA 197

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A iH++LY+sed++ v++++Yl+ L+e+L ++ ++ ++ ++ l
CP001298_5 198 IAGIHRRLYTSEDVEAVELDAYLTGLVEELQLAMKASGRDHAIR--L 242

CP001298_0479: domain 1 of 1, from 219 to 304: score 103.5, E = 3.7e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI+HRVKN+L ++++LL++Q r + +++ + aL ++ RV++
CP001298_0 219 EINHRVKNSLSIVAGLLSMQGRAAANPDL-----RQALDGARARVQT 260

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H++L++++++ v+++e++ +L+e+L++s++ g L +D
CP001298_0 261 IASVHDRLWRTDEIHAVNLAEFMGELCEQLRSSARPGQT---LTCDF 304

CP001298_4781: domain 1 of 1, from 191 to 272: score 102.8, E = 6e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L+v+++LL LQar +++e+v + aL +++ RV +
CP001298_4 191 EMSHRVKNSLAVVAGLLALQARGTDNEDV-----KCALADARARVEA 232

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++L++ dl ++d++ +le L+e L +++g + +
CP001298_4 233 VAQVHDQLWRQPDLTRIDVAGFLEALCEKLTETAGAHAL-------V 272

CP001298_4213: domain 1 of 1, from 172 to 258: score 90.6, E = 1.8e-25
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKNNLQvISSL L ar++ + ++ ++aL+ +R+ +
CP001298_4 172 EVDHRVKNNLQVISSLMLLKARRTPEGDA-----RNALQAMADRIGA 213

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++ H++LY +d+ + df+e+ L+++L g+++d+ +++ ++
CP001298_4 214 LSTAHRMLYSEGDVTRFDFREFTADLIADLAA--GLDGDRTRIETEI 258

CP001298_0436: domain 1 of 1, from 157 to 240: score 69.7, E = 1.5e-19
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HRV+NNLQv+ SL+ L r + + + + + +RV++
CP001298_0 157 EIYHRVRNNLQVMVSLIGLYGRAAPEA-C-----RGSFDALGQRVRA 197

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al++++L++ + ++d+++Yl +L++ L q+ + g++g+ +
CP001298_0 198 IALVQQHLHEAPHIASIDLRDYLHRLASGLGQLRRAGRIGVT----V 240

CP001298_4359: domain 1 of 1, from 155 to 237: score 68.6, E = 3.2e-19
*->EIHHRVKNNLQvISSLLrLQarkfkd..eevikdEVleaLrEsqnRV
E +HRV NN+Q +++LL LQ rk+ d+++e+ +++ E+q R
CP001298_4 155 ELQHRVANNMQFVAALLALQKRKVIDnpQEA-----ADVFDEAQARL 196

lSmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<
+++A iH++LY + +++Yl++L+++L+++ g +++ +
CP001298_4 197 QTIARIHRRLYDPAR-ADQPVGQYLQELCSDLLDATGARNI-------V 237

-*

CP001298_4 - -

CP001298_3454: domain 1 of 1, from 163 to 211: score 40.9, E = 2.3e-11
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HR +N LQ+IS++L LQ+ ++ d++v ++aL E+++R+ +
CP001298_3 163 EIGHRARNDLQMISAMLTLQSGNSADPAV-----RAALGEAIGRIDA 204

mAliHEe<-*
++++++
CP001298_3 205 LSTLYRQ 211


Histogram of all scores:
score obs exp (one = represents 26 sequences)
----- --- ---
-15 21 0|=
-14 65 0|===
-13 155 32|=*====
-12 382 339|=============*=
-11 1501 946|====================================*=====================
-10 1085 1224|========================================== *
-9 774 1034|============================== *
-8 519 693|==================== *
-7 271 411|=========== *
-6 197 229|========*
-5 67 123|=== *
-4 47 65|==*
-3 34 34|=*
-2 20 17|*
-1 12 9|*
0 6 4|*
1 0 2|*
2 0 1|*
3 2 0|=
4 1 0|=
> 5 14 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 1005.1845
P(chi-square) = 0

Total sequences searched: 5173

Whole sequence top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: