Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Methylobacterium chloromethanicum CM4  

Data for CP001298  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001298.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001298_1262 CDS_1390935-1387885 131.7 1.3e-44 1
CP001298_0783 CDS_853683-852217 129.4 8.1e-44 1
CP001298_3473 CDS_3817302-3815551 124.2 4.8e-42 1
CP001298_3206 CDS_3535007-3533997 112.7 4.1e-38 1
CP001298_4071 CDS_4504573-4501781 111.9 7.5e-38 1
CP001298_2175 CDS_2414254-2416395 110.3 2.6e-37 1
CP001298_0472 CDS_504581-505591 104.5 2.5e-35 1
CP001298_1183 CDS_1290139-1288637 99.6 1.2e-33 1
CP001298_2254 CDS_2519338-2521305 96.7 1.1e-32 1
CP001298_4600 CDS_5091213-5089351 96.0 2e-32 1
CP001298_0824 CDS_889922-893320 85.2 9.2e-29 2
CP001298_4797 CDS_5347715-5351005 65.1 6.6e-22 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001298_1262 1/1 817 899 .. 1 85 [] 131.7 1.3e-44
CP001298_0783 1/1 297 379 .. 1 85 [] 129.4 8.1e-44
CP001298_3473 1/1 385 472 .. 1 85 [] 124.2 4.8e-42
CP001298_3206 1/1 147 227 .. 1 85 [] 112.7 4.1e-38
CP001298_4071 1/1 727 809 .. 1 85 [] 111.9 7.5e-38
CP001298_2175 1/1 500 586 .. 1 85 [] 110.3 2.6e-37
CP001298_0472 1/1 147 227 .. 1 85 [] 104.5 2.5e-35
CP001298_1183 1/1 302 385 .. 1 85 [] 99.6 1.2e-33
CP001298_2254 1/1 454 537 .. 1 85 [] 96.7 1.1e-32
CP001298_4600 1/1 421 504 .. 1 85 [] 96.0 2e-32
CP001298_0824 2/2 925 1008 .. 1 85 [] 83.3 4.2e-28
CP001298_4797 1/1 753 834 .. 1 85 [] 65.1 6.6e-22

Alignments of top-scoring domains:
CP001298_1262: domain 1 of 1, from 817 to 899: score 131.7, E = 1.3e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtL++VQ+ia QTlRna++ld+++eaF++RL +L+raHd+
CP001298_1 817 ELQHRVKNTLTLVQAIASQTLRNAPDLDAAREAFAARLISLGRAHDI 863

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltrs+W A ++e++e +La ++g++ Ri+ sGP+
CP001298_1 864 --LTRSSWTEAPIAEVVEGALAVHRGAAMARIRASGPS 899

CP001298_0783: domain 1 of 1, from 297 to 379: score 129.4, E = 8.1e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HRVKNt+A+VQSia+QTlRnaasld++++++++RL +L++aHd+
CP001298_0 297 EMKHRVKNTIATVQSIAHQTLRNAASLDDARRTLDARLNSLAAAHDI 343

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt + ag++L+e +e++L+P++ + Ri++ GP+
CP001298_0 344 --LTTEATAGVTLAEAVESALQPFRVSPRNRIRFGGPE 379

CP001298_3473: domain 1 of 1, from 385 to 472: score 124.2, E = 4.8e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ+i+ T+R+a+s+d+f+eaF gR+ +L+ +H++
CP001298_3 385 ELHHRVKNTLATVQAIVGSTARTATSIDSFHEAFVGRIKSLAHTHSV 431

VpLtrseWagAdLreLleaeLaPygged.....aeRitlsGPd<-*
Lt++ W+ A+Lr+Ll++eL Py+ ++++++ Ri+l+GP+
CP001298_3 432 --LTEATWQTASLRDLLASELMPYAESEtetspDLRIVLDGPA 472

CP001298_3206: domain 1 of 1, from 147 to 227: score 112.7, E = 4.1e-38
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ++ + T+R+ + ef +aFsgR+++L+r+H L
CP001298_3 147 ELHHRVKNTLATVQAVLNATARSPLPVSEFIRAFSGRIASLARTHAL 193

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t++ ++ A++ Ll+aeL+Pyg +R+tl+GP+
CP001298_3 194 --ITEDVAQAASFEGLLRAELDPYGE--KGRLTLEGPR 227

CP001298_4071: domain 1 of 1, from 727 to 809: score 111.9, E = 7.5e-38
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KNtL++ Q+ia QTlRna+++++ +ea+ +RL+AL+ aHd+
CP001298_4 727 ELSHRLKNTLTMAQAIASQTLRNATDIASVKEALVARLVALGKAHDI 773

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L e++gA L ++++ +L +++ ++Ri+lsGPd
CP001298_4 774 --LLSGEGEGAALEAVIAGALTIHDDGEPGRIHLSGPD 809

CP001298_2175: domain 1 of 1, from 500 to 586: score 110.3, E = 2.6e-37
*->ELnHRVKNtLAvVQSiarQTlRn..aasldefveaFsgRLqALsraH
ELnHRVKNtLA+VQSia Q+lR+ + ++ ++++aF++RL AL+raH
CP001298_2 500 ELNHRVKNTLATVQSIAMQSLRGldGEEALAARAAFEARLLALARAH 546

dLVpLtrseWagAdLreLleaeLaPygged..aeRitlsGPd<-*
d+ Ltr++W+gA+L+ ++ +++P ++ d+++ R+++sGP+
CP001298_2 547 DV--LTRESWEGAELKTVVGDAIRPLEAGDgqESRFVVSGPR 586

CP001298_0472: domain 1 of 1, from 147 to 227: score 104.5, E = 2.5e-35
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ++ + T+R+ + ef aF+gR+ +L+r+H L
CP001298_0 147 ELHHRVKNTLATVQAVLNATARSRLPVSEFISAFTGRISSLARTHAL 193

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t++ ++ A++ Ll+aeL+Pyg ++R+tl+GP
CP001298_0 194 --ITEDAAQAASFEGLLRAELDPYGE--RGRLTLDGPK 227

CP001298_1183: domain 1 of 1, from 302 to 385: score 99.6, E = 1.2e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+LAvV Sia+QT +++ ++f ++F +RL+ALsr+++L
CP001298_1 302 ELQHRTRNLLAVVRSIAQQTMTQTGPTEQFCDRFNDRLAALSRVQGL 348

VpLtrseWagAdLreLleaeLaPygged.aeRitlsGPd<-*
L+rs+ ++ ++ +L+++eL+++g ++ + R+ l GP+
CP001298_1 349 --LSRSDKEPITIQALIQIELDAFGVAAmQARVALKGPP 385

CP001298_2254: domain 1 of 1, from 454 to 537: score 96.7, E = 1.1e-32
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+L vV Sia+QT +++ + f+e+F +RL+ALsr+++L
CP001298_2 454 ELQHRTRNLLGVVRSIAHQTMAQTGPTERFREQFNDRLAALSRVQGL 500

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L+rse ++ +Lr L++ eL++ gg + a Ri++ GP+
CP001298_2 501 --LSRSEQEPITLRTLIRTELDALGGGdFANRIHIAGPP 537

CP001298_4600: domain 1 of 1, from 421 to 504: score 96.0, E = 2e-32
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+L+vV +ia+QT +++ + f+e F +RL+ALsr+++L
CP001298_4 421 ELQHRTRNLLTVVRAIAQQTMAQTGPTALFREHFNDRLAALSRVQGL 467

VpLtrseWagAdLreLleaeLaPygged.aeRitlsGPd<-*
L+rs+ ++ ++r+L+e+eL++ g+ d +eRi ++GP+
CP001298_4 468 --LSRSDQEPITIRALVEMELDALGATDmGERIAVEGPR 504

CP001298_0824: domain 2 of 2, from 925 to 1008: score 83.3, E = 4.2e-28
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+++vV S+a QT +++s++ f+++F +RL+ Lsr+++L
CP001298_0 925 ELQHRTRNLITVVRSLAEQTMARSDSMPMFRARFYDRLAVLSRVQGL 971

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L+rs ++ +L++L++ eL++ g+ ++++Ri l+GP+
CP001298_0 972 --LSRSTIEPITLHALIATELDALGAWeASDRIYLDGPS 1008

CP001298_4797: domain 1 of 1, from 753 to 834: score 65.1, E = 6.6e-22
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+N++Av Si++ T +a+++ +++ + gRL L+r++ L
CP001298_4 753 ELQHRVRNIMAVTRSIVARTGERAETVSDYASLVGGRLLTLARVQAL 799

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltrs ag+ + +++ e+++ + a++ lsGP
CP001298_4 800 --LTRSPNAGVPVATIVRDEIDAQDLR-ADQYDLSGPK 834


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-15 1 0|=
-14 18 0|==
-13 83 0|=====
-12 372 0|======================
-11 436 42|==*=======================
-10 681 534|===============================*=========
-9 890 1324|===================================================== *
-8 961 1374|========================================================= *
-7 653 923|======================================= *
-6 414 503|========================= *
-5 265 249|==============*=
-4 162 118|======*===
-3 93 54|===*==
-2 59 25|=*==
-1 29 11|*=
0 11 5|*
1 12 2|*
2 9 1|*
3 2 0|=
4 3 0|=
> 5 19 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4189.3726
P(chi-square) = 0

Total sequences searched: 5173

Whole sequence top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: