Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Rhodobacter capsulatus SB 1003  

Data for CP001312  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001312.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001312_2257 CDS_2466977-2468740 90.8 1e-25 1
CP001312_2259 CDS_2470067-2469060 55.3 1.3e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001312_2257 1/1 374 460 .. 1 94 [] 90.8 1e-25
CP001312_2259 1/1 140 190 .. 1 56 [. 55.3 1.3e-15

Alignments of top-scoring domains:
CP001312_2257: domain 1 of 1, from 374 to 460: score 90.8, E = 1e-25
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+I+S+L++Q r+++ e+ ++a+r q RVlS
CP001312_2 374 EVHHRVKNNLQLIASILNMQLRRARTDEA-----RAAMRNVQERVLS 415

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
A+iH+eLY + + ++ +e l +++++ ++ + +L+ l
CP001312_2 416 LATIHRELYLTSGQTDIRADELLPRIAAHVLKIGTTPERQFDLD--L 460

CP001312_2259: domain 1 of 1, from 140 to 190: score 55.3, E = 1.3e-15
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRV NNLQvI ++Lr++ rk +d+e + aLr + +R
CP001312_2 140 ELQHRVSNNLQVIGAILRMEERKMRDPEG-----RQALRAAASRLGV 181

mAliHEeLY<-*
+A ++++L+
CP001312_2 182 IAAVQRQLH 190


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-15 12 0|=
-14 24 0|==
-13 41 21|=*=
-12 223 229|=============*
-11 995 638|=====================================*=====================
-10 772 826|============================================== *
-9 544 698|================================ *
-8 403 468|======================== *
-7 181 278|=========== *
-6 161 154|=========*
-5 53 83|====*
-4 46 44|==*
-3 19 23|=*
-2 5 12|*
-1 7 6|*
0 3 3|*
1 0 1|*
2 1 0|=
3 0 0|
4 0 0|
> 5 3 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 312.7008
P(chi-square) = 0

Total sequences searched: 3493

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: