Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for Desulfatibacillum alkenivorans AK-01  

Data for CP001322  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001322.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001322_2550 CDS_3340407-3337909 73.2 3.5e-21 2
CP001322_4965 CDS_6168783-6170615 47.8 1.1e-13 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001322_2550 2/2 629 696 .. 1 70 [] 68.2 1e-19
CP001322_4965 1/1 405 472 .. 1 70 [] 47.8 1.1e-13

Alignments of top-scoring domains:
CP001322_2550: domain 2 of 2, from 629 to 696: score 68.2, E = 1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD++gQ L+++++ + + +++l ++ +++ +e++ ++
CP001322_2 629 ERQAIARELHDELGQILTVLRMDAVWFKKRL--KDSDAATQERASAM 673

relarealaevRrllgdLRpaal<-*
el+++++++vR ++ +LRp++l
CP001322_2 674 CELIDKTIEDVRGIAVRLRPGVL 696

CP001322_4965: domain 1 of 1, from 405 to 472: score 47.8, E = 1.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +A ELHD++gQsL+a+k ++ ++ + d ++ +r+ +++
CP001322_4 405 ERRQLAIELHDGIGQSLTAVKFSVDNILLNI--DNPDLNVRDITKTA 449

relarealaevRrllgdLRpaal<-*
++++ ++a+vRr+ +LRp +l
CP001322_4 450 SQIIKASIADVRRMQVELRPRIL 472


Histogram of all scores:
score obs exp (one = represents 19 sequences)
----- --- ---
-14 24 0|==
-13 92 0|=====
-12 166 58|===*=====
-11 307 481|================= *
-10 908 1116|================================================ *
-9 1081 1268|========================================================= *
-8 838 977|============================================= *
-7 631 614|================================*=
-6 470 347|==================*======
-5 330 186|=========*========
-4 180 97|=====*====
-3 99 50|==*===
-2 57 25|=*=
-1 20 13|*=
0 14 6|*
1 8 3|*
2 11 1|*
3 6 0|=
4 3 0|=
5 2 0|=
6 0 0|
7 1 0|=
8 1 0|=
9 0 0|
> 10 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 668.2493
P(chi-square) = 0

Total sequences searched: 5252

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: