Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

1 accessions found for Chloroflexus aggregans DSM 9485  

Data for CP001337  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001337.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001337_2713 CDS_3441517-3442785 91.9 7.6e-27 1
CP001337_0334 CDS_425628-423451 91.1 1.3e-26 1
CP001337_1517 CDS_1918172-1916784 80.0 2.5e-23 1
CP001337_2217 CDS_2794032-2795822 69.8 2.5e-20 1
CP001337_1855 CDS_2345575-2346636 69.5 3.1e-20 2
CP001337_2729 CDS_3463531-3461894 67.7 1.1e-19 1
CP001337_3552 CDS_4464006-4462537 59.3 3.2e-17 1
CP001337_1299 CDS_1665944-1666960 56.2 2.6e-16 1
CP001337_1715 CDS_2161354-2163354 53.8 1.3e-15 2
CP001337_2496 CDS_3148970-3147378 51.6 6.1e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001337_2713 1/1 213 281 .. 1 70 [] 91.9 7.6e-27
CP001337_0334 1/1 519 586 .. 1 70 [] 91.1 1.3e-26
CP001337_1517 1/1 257 324 .. 1 70 [] 80.0 2.5e-23
CP001337_2217 1/1 390 457 .. 1 70 [] 69.8 2.5e-20
CP001337_2729 1/1 338 405 .. 1 70 [] 67.7 1.1e-19
CP001337_1855 2/2 150 217 .. 1 70 [] 65.2 5.6e-19
CP001337_3552 1/1 278 343 .. 1 70 [] 59.3 3.2e-17
CP001337_1299 1/1 135 203 .. 1 70 [] 56.2 2.6e-16
CP001337_2496 1/1 317 382 .. 1 70 [] 51.6 6.1e-15
CP001337_1715 2/2 465 516 .. 1 54 [. 46.0 2.6e-13

Alignments of top-scoring domains:
CP001337_2713: domain 1 of 1, from 213 to 281: score 91.9, E = 7.6e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARE+HD++g++L+a+++ql++a+rll +dpe+a++al+ +
CP001337_2 213 ERVRLAREIHDGLGHHLTALNVQLQAAARLL--NRDPERAAQALAIC 257

relarealaevRrllgdLR.paal<-*
re a+ al+evR+ + ++R+ ++
CP001337_2 258 REEAQAALNEVRQSVAVMRnAPVN 281

CP001337_0334: domain 1 of 1, from 519 to 586: score 91.1, E = 1.3e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHDsv+Q+L++++l +++ar ++ +++p+++ l+++
CP001337_0 519 ERNRLARELHDSVSQQLFSMTLTAQAARSQF--ERNPARVPVLLERL 563

relarealaevRrllgdLRpaal<-*
+e+a alae+R+l+ +LRp+al
CP001337_0 564 HETATAALAEMRALIFQLRPPAL 586

CP001337_1517: domain 1 of 1, from 257 to 324: score 80.0, E = 2.5e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD+v+QsL+ +++ ++l + l + +pe++re++ +
CP001337_1 257 ERTRIARDLHDGVAQSLAFMRMRIDLWEDWL--QQEPERLREEFVTF 301

relarealaevRrllgdLRpaal<-*
++ +r+ ++e+Rr++ +LRp +
CP001337_1 302 KANLRRQIEELRRAIFALRPIEI 324

CP001337_2217: domain 1 of 1, from 390 to 457: score 69.8, E = 2.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ +AR+LHD+ +Qs+++i++++e ++rll ++dp++a +lde+
CP001337_2 390 VRHQLARDLHDGPAQSMAVITMKAEFIKRLL--ERDPAQALVELDEL 434

relarealaevRrllgdLRpaal<-*
++a+++ evR +l +LRp l
CP001337_2 435 STIAKRTNYEVRTMLFELRPLML 457

CP001337_2729: domain 1 of 1, from 338 to 405: score 67.7, E = 1.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IAR+LHD+ Qs++ai++ +e ++rl+ ++ pe++ ++ld++
CP001337_2 338 VRHAIARDLHDGPTQSIAAIAMNIEFIKRLF--KAMPERVPAELDTL 382

relarealaevRrllgdLRpaal<-*
+el++++ ++R+ll +LRp +l
CP001337_2 383 AELVQKTTHDIRNLLFELRPLGL 405

CP001337_1855: domain 2 of 2, from 150 to 217: score 65.2, E = 5.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI+ +HD+ +Q++s + l +e ++rll d+d ++ar++l ++
CP001337_1 150 ERLRISLQMHDGPAQAMSNLVLRAEICQRLL--DRDLDQARAELVAL 194

relarealaevRrllgdLRpaal<-*
+ +++ +l+e+R + dLRp++l
CP001337_1 195 KNAVNNTLQETRKFIFDLRPMTL 217

CP001337_3552: domain 1 of 1, from 278 to 343: score 59.3, E = 3.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHDs +Q+L+++ ++l ++ d + + +e+ +++de+
CP001337_3 278 ERKRIARELHDSTSQALTSLLIGLRSLA---D-RHHSPELHRQVDEL 320

relarealaevRrllgdLRpaal<-*
r+++ + l ++ +l+++LRp++l
CP001337_3 321 RGIVGQVLHDLHALARQLRPSVL 343

CP001337_1299: domain 1 of 1, from 135 to 203: score 56.2, E = 2.6e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARE HD+ +Q L+ + +++e+++ ll + + e++ l ++
CP001337_1 135 ERIRLAREVHDGPAQVLANALMGVEVCQNLLK-EQNFERLGSILSQL 180

relarealaevRrllgdLRpaal<-*
+ +re+l++vR + dLRp+ l
CP001337_1 181 GDSVREGLRDVRSFIADLRPGKL 203

CP001337_2496: domain 1 of 1, from 317 to 382: score 51.6, E = 6.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD v Q L + + qle ++ + +++ e +l+ i
CP001337_2 317 ERKALARELHDQVIQDLLSFNYQLEHLEEEI--EAA--ETVHELQVI 359

relarealaevRrllgdLRpaal<-*
r+ +re +R++ +dLRp++l
CP001337_2 360 RRGIREVVGMLRQICSDLRPPTL 382

CP001337_1715: domain 2 of 2, from 465 to 516: score 46.0, E = 2.6e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARE HD +g L +++l l+la l+ +dp++ar++l++
CP001337_1 465 ERLRLAREVHDDLGSKLVLMNLELQLATELA--GEDPAKARDHLANS 509

relarea<-*
rel++ a
CP001337_1 510 RELLHSA 516


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 3 0|=
-13 35 0|====
-12 50 41|====*
-11 94 341|========== *
-10 337 793|================================== *
-9 550 900|======================================================= *
-8 496 694|================================================== *
-7 541 436|===========================================*===========
-6 466 247|========================*======================
-5 424 132|=============*=============================
-4 247 69|======*==================
-3 167 35|===*=============
-2 117 18|=*==========
-1 61 9|*======
0 45 4|*====
1 36 2|*===
2 19 1|*=
3 10 0|=
4 10 0|=
5 5 0|=
6 2 0|=
7 1 0|=
8 1 0|=
9 1 0|=
10 1 0|=
> 11 11 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3267.0466
P(chi-square) = 0

Total sequences searched: 3730

Whole sequence top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: