Crenarchaeota Euryarchaeota Nanoarchaeota
Other Archaea
Classification of phyla is from NCBI page
Search:
82 projects found  

1 accessions found for Methanosphaerula palustris E1-9c  

Data for CP001338  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001338.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001338_0077 CDS_88365-85636 129.2 9.1e-37 1
CP001338_0046 CDS_45210-48152 128.3 1.7e-36 1
CP001338_1687 CDS_1856595-1858202 54.6 1.5e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001338_0077 1/1 703 786 .. 1 94 [] 129.2 9.1e-37
CP001338_0046 1/1 785 873 .. 1 94 [] 128.3 1.7e-36
CP001338_1687 1/1 336 410 .. 11 94 .] 54.6 1.5e-15

Alignments of top-scoring domains:
CP001338_0077: domain 1 of 1, from 703 to 786: score 129.2, E = 9.1e-37
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNL+vI+SL++LQa+ ++de + l +L++ ++RV++
CP001338_0 703 EIHHRVKNNLAVIISLIDLQADDITDEQT-----LQLLHDLRGRVAT 744

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE LY s+dl++++f++Yl+ L+ L+qs g++ +k +
CP001338_0 745 MALVHEFLYGSRDLSQINFGQYLQDLVPKLIQSLGGSTP---VK--V 786

CP001338_0046: domain 1 of 1, from 785 to 873: score 128.3, E = 1.7e-36
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLL LQ+ ++++ + +LrE+++RV+S
CP001338_0 785 EIHHRVKNNLQTISSLLYLQSLSTDNIGQ-----ISLLREARSRVIS 826

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m liH++LY+s d+ + f +Y++ L++ L +sygv+ d+i+ +D+
CP001338_0 827 MGLIHQKLYQSADIAHIQFMDYIRGLIDFLEESYGVDPDKIQTFVDV 873

CP001338_1687: domain 1 of 1, from 336 to 410: score 54.6, E = 1.5e-15
*->QvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlSmAliHEeLYk
Q+I SL +LQ ++ + l + rEsqnR+++ AliHE L +
CP001338_1 336 QLIQSLFDLQKQYCTIATD-----LGIIRESQNRIAALALIHEVLEE 377

sedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
s d + + +++Y ++L+e +f++y ++ + + +
CP001338_1 378 SADPEHIPIRDYTQRLVELIFSTYIHDTEQVT----V 410


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-15 3 0|=
-14 14 0|=
-13 44 16|=*==
-12 171 174|============*
-11 778 485|==================================*=====================
-10 508 628|===================================== *
-9 425 530|=============================== *
-8 311 356|======================= *
-7 152 211|=========== *
-6 133 117|========*=
-5 38 63|=== *
-4 31 33|==*
-3 20 17|=*
-2 8 9|*
-1 9 4|*
0 2 2|*
1 0 1|*
2 2 0|=
3 0 0|
4 2 0|=
5 0 0|
> 6 4 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 300.6468
P(chi-square) = 0

Total sequences searched: 2655

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: