Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Caulobacter crescentus NA1000  

Data for CP001340  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001340.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001340_3270 CDS_3441214-3442635 162.4 3.5e-55 1
CP001340_3141 CDS_3296371-3294602 155.3 9.4e-53 1
CP001340_0877 CDS_956807-959071 142.3 2.5e-48 1
CP001340_3152 CDS_3309667-3311148 141.7 4.1e-48 1
CP001340_0663 CDS_721949-723094 139.9 1.7e-47 1
CP001340_2635 CDS_2788093-2789109 139.4 2.4e-47 1
CP001340_1753 CDS_1883452-1881785 133.6 2.3e-45 1
CP001340_3001 CDS_3156484-3158154 128.3 1.5e-43 1
CP001340_3673 CDS_3834296-3836134 127.5 2.8e-43 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001340_3270 1/1 279 360 .. 1 85 [] 162.4 3.5e-55
CP001340_3141 1/1 388 471 .. 1 85 [] 155.3 9.4e-53
CP001340_0877 1/1 568 648 .. 1 85 [] 142.3 2.5e-48
CP001340_3152 1/1 173 253 .. 1 85 [] 141.7 4.1e-48
CP001340_0663 1/1 186 268 .. 1 85 [] 139.9 1.7e-47
CP001340_2635 1/1 143 224 .. 1 85 [] 139.4 2.4e-47
CP001340_1753 1/1 372 448 .. 1 85 [] 133.6 2.3e-45
CP001340_3001 1/1 368 444 .. 1 85 [] 128.3 1.5e-43
CP001340_3673 1/1 282 361 .. 1 85 [] 127.5 2.8e-43

Alignments of top-scoring domains:
CP001340_3270: domain 1 of 1, from 279 to 360: score 162.4, E = 3.5e-55
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQS+a+QTlRn++s++ + e+F++RL+ Ls++Hd+
CP001340_3 279 ELNHRVKNTLATVQSMAAQTLRNEPSPAVAFEKFEARLMGLSGVHDI 325

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W gA Lre++e++L+P+ +e+++Ri++ GP+
CP001340_3 326 --LTRESWHGAPLREVAERALRPF-DEGGTRIEIAGPP 360

CP001340_3141: domain 1 of 1, from 388 to 471: score 155.3, E = 9.4e-53
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA +QSiarQTlR + ++ ++++F++RL+A+s+aH++
CP001340_3 388 ELNHRVKNTLASIQSIARQTLRADEVSPRARDQFIDRLMAMSAAHNV 434

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
Lt ++W+gA + ++l+++L+P+++++d+eRit++GP+
CP001340_3 435 --LTNERWSGAVIDDILREALRPFCDDrDPERITITGPS 471

CP001340_0877: domain 1 of 1, from 568 to 648: score 142.3, E = 2.5e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA++Q+ia+Q++++ +++de++eaFs R++AL++aHdL
CP001340_0 568 ELNHRVKNSLATIQAIAAQSFNGQRDMDEAKEAFSNRIVALAEAHDL 614

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W+gA++++++++ a +gg + R++lsG +
CP001340_0 615 --LTRENWEGAEMHDVAARVAALHGG--DARFELSGVA 648

CP001340_3152: domain 1 of 1, from 173 to 253: score 141.7, E = 4.1e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR KN L+vVQS+a+ T + +s+d++v+a+sgR+ +L+raH+L
CP001340_3 173 EVDHRAKNVLTVVQSLAQLT--PFESKDQYVQALSGRIGSLARAHSL 217

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ ++W+g+dL++Lle eL+Pygge++e+i + GP+
CP001340_3 218 --LSTTRWSGVDLHDLLELELDPYGGEAGEQIAILGPP 253

CP001340_0663: domain 1 of 1, from 186 to 268: score 139.9, E = 1.7e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQSi rQTlR+++s+++f++ F+ R+ ALs+aH L
CP001340_0 186 ELDHRVKNTLAIVQSITRQTLRTTPSPEAFADVFESRILALSQAHEL 232

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr+ W+ L e+l+++La ++++ a+R++++GP+
CP001340_0 233 --LTRRAWGRPQLEEILQRTLATFADDVAGRFEVQGPA 268

CP001340_2635: domain 1 of 1, from 143 to 224: score 139.4, E = 2.4e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQSia+Q+lRna+ ++ ++a++gRL+A +++H++
CP001340_2 143 ELNHRVKNTLATVQSIANQSLRNAGVDASVRDALEGRLMAIAATHNV 189

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+ +W+ A+Lr+++ + Py+++ ++++t+sG+d
CP001340_2 190 --LTDQNWSAASLRQIVDGSVTPYRAN-PGQLTISGDD 224

CP001340_1753: domain 1 of 1, from 372 to 448: score 133.6, E = 2.3e-45
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtL vVQS+ar++l+ + + +++F RL AL++aHdL
CP001340_1 372 ELNHRVKNTLVVVQSLARHSLK--GGGELGLAQFNERLLALAGAHDL 416

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W+gAdL+eL++++L+Py a+++ ++GP+
CP001340_1 417 --LTRRSWEGADLGELVAEALQPY----ATQVSIEGPA 448

CP001340_3001: domain 1 of 1, from 368 to 444: score 128.3, E = 1.5e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQ++arQT +a + ++ F++RL ALs+aHdL
CP001340_3 368 ELNHRVKNTLATVQALARQT--FAKVDGAPLGVFTDRLIALSGAHDL 412

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr+ W+ Ad+++L+ea L+++ ++R+ +GP+
CP001340_3 413 --LTRTGWREADMAALIEASLGAH----GDRVDREGPT 444

CP001340_3673: domain 1 of 1, from 282 to 361: score 127.5, E = 2.8e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+LAvVQS+a+Q++R +asld f+ +F++RL ++s+aHdL
CP001340_3 282 ELDHRIKNLLAVVQSVAAQSARKSASLDVFLKTFAARLKSMSSAHDL 328

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ ++W+gA+L+ +++aeL+ + +++ +++GP+
CP001340_3 329 --LSAARWRGATLARIAAAELGGLA---PTQTRWDGPE 361


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-15 1 0|=
-14 18 0|==
-13 48 0|====
-12 265 0|=====================
-11 329 31|==*=======================
-10 512 400|==============================*=========
-9 706 992|======================================================= *
-8 760 1030|==========================================================*
-7 476 692|===================================== *
-6 314 377|========================= *
-5 181 187|==============*
-4 97 88|======*=
-3 79 41|===*===
-2 42 18|=*==
-1 17 8|*=
0 7 3|*
1 10 1|*
2 1 0|=
3 1 0|=
> 4 13 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 3124.0959
P(chi-square) = 0

Total sequences searched: 3877

Whole sequence top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: