Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

3 accessions found for Arthrobacter chlorophenolicus A6  

Data for CP001341  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001341.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001341_2231 CDS_2544953-2546146 90.8 1.7e-26 1
CP001341_3862 CDS_4363237-4361861 87.1 2.1e-25 1
CP001341_0638 CDS_688402-687200 63.6 1.8e-18 1
CP001341_3335 CDS_3748183-3746882 59.4 3.1e-17 1
CP001341_1682 CDS_1913122-1914729 57.4 1.2e-16 1
CP001341_2828 CDS_3197959-3196550 36.8 1.4e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001341_2231 1/1 190 257 .. 1 70 [] 90.8 1.7e-26
CP001341_3862 1/1 222 289 .. 1 70 [] 87.1 2.1e-25
CP001341_0638 1/1 194 259 .. 1 70 [] 63.6 1.8e-18
CP001341_3335 1/1 224 292 .. 1 70 [] 59.4 3.1e-17
CP001341_1682 1/1 341 406 .. 1 70 [] 57.4 1.2e-16
CP001341_2828 1/1 251 315 .. 1 70 [] 36.8 1.4e-10

Alignments of top-scoring domains:
CP001341_2231: domain 1 of 1, from 190 to 257: score 90.8, E = 1.7e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa+IARE+HD v++sLs+i+ q+++ar+++ +++p a e+l+++
CP001341_2 190 ERAHIAREMHDIVAHSLSVIITQSDGARYAA--ATNPSVATETLATV 234

relarealaevRrllgdLRpaal<-*
+++ar++lae+Rrllg+LR+++
CP001341_2 235 AATARTSLAEMRRLLGVLRHGDG 257

CP001341_3862: domain 1 of 1, from 222 to 289: score 87.1, E = 2.1e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v++sL++++ +++a ++ +k pe+a e l e+
CP001341_3 222 ERNRIAREMHDVVAHSLTVMISLSDGAGVVV--RKSPERAGEVLGEL 266

relarealaevRrllgdLRpaal<-*
+++r+ala++Rr+lg+LR++a
CP001341_3 267 SRTGRTALADMRRVLGVLRDDAG 289

CP001341_0638: domain 1 of 1, from 194 to 259: score 63.6, E = 1.8e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R +RE+HD+v Q+L++ l le+a r +++ +a + l+++
CP001341_0 194 ERERVSREIHDTVTQGLASSLLLLEAAGRTW--PAP--AAHADLRQA 236

relarealaevRrllgdLRpaal<-*
l+r+ lae+R l++dL ++l
CP001341_0 237 TSLLRDNLAETRSLVHDLASPGL 259

CP001341_3335: domain 1 of 1, from 224 to 292: score 59.4, E = 3.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+R+ARE+HD+++Q+Ls+i l +a++ l + + ++a+ +l+
CP001341_3 224 ERERLAREIHDTLAQGLSSIVLLGRAAEQSL--AGGDStAAASQLEL 268

irelarealaevRrllgdLRpaal<-*
++++a e lae+R +++L ++l
CP001341_3 269 VQRTAAENLAEARSFVRGLSSPQL 292

CP001341_1682: domain 1 of 1, from 341 to 406: score 57.4, E = 1.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIA +LHD v Q+L+a+ l ++ +rr + +++ ++++ i
CP001341_1 341 DRDRIAKDLHDLVIQRLFAAGLSIQSLRRTT--TDP--HSLKRITII 383

relarealaevRrllgdLRpaal<-*
+ ++++++++R+++ LRp +
CP001341_1 384 TTELDDCIRQLRDTIYSLRPRGP 406

CP001341_2828: domain 1 of 1, from 251 to 315: score 36.8, E = 1.4e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IA ELHD v Q+Ls+++ le + ++ + ++ ++ +
CP001341_2 251 ERRQIASELHDDVIQNLSGLAYALESEE-----RRGQPGQQQVFADA 292

relarealaevRrllgdLRpaal<-*
r+++++ ++ +R++ ++L p++l
CP001341_2 293 RTMLQRDIKALRAMTSELYPPDL 315


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 6 0|=
-13 42 0|====
-12 72 43|===*==
-11 150 356|============= *
-10 481 826|========================================= *
-9 675 938|========================================================= *
-8 621 723|==================================================== *
-7 542 454|=====================================*========
-6 413 257|=====================*=============
-5 354 137|===========*==================
-4 192 72|=====*==========
-3 139 37|===*========
-2 84 18|=*=====
-1 42 9|*===
0 27 4|*==
1 13 2|*=
2 13 1|*=
3 7 0|=
4 2 0|=
5 1 0|=
6 0 0|
7 0 0|
> 8 9 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1632.3588
P(chi-square) = 0

Total sequences searched: 3885

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: