Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
39 projects found  

4 accessions found for Cyanothece sp. PCC 7425  

Data for CP001344  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001344.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001344_2101 CDS_2270135-2281255 153.7 1.8e-43 1
CP001344_0795 CDS_819592-816794 152.3 4.8e-43 1
CP001344_1918 CDS_2054560-2051723 152.2 5.2e-43 1
CP001344_0794 CDS_816777-814753 152.1 5.5e-43 1
CP001344_1151 CDS_1191821-1196503 151.1 1e-42 1
CP001344_2002 CDS_2153801-2148771 147.9 8.2e-42 1
CP001344_3461 CDS_3718830-3715279 142.3 3.4e-40 1
CP001344_3623 CDS_3916983-3918824 140.2 1.3e-39 1
CP001344_3234 CDS_3455780-3457537 136.6 1.3e-38 1
CP001344_3858 CDS_4187533-4190271 133.8 8.8e-38 1
CP001344_4021 CDS_4358717-4366798 131.6 3.6e-37 1
CP001344_3857 CDS_4184998-4187370 123.1 9.6e-35 1
CP001344_4148 CDS_4506158-4503855 121.3 3.1e-34 1
CP001344_3860 CDS_4193617-4196358 118.5 2e-33 1
CP001344_4776 CDS_5168928-5170367 108.0 1.9e-30 1
CP001344_3859 CDS_4190367-4193522 107.1 3.4e-30 1
CP001344_4022 CDS_4366831-4367862 102.3 7.9e-29 1
CP001344_2102 CDS_2281261-2282319 99.0 6.9e-28 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001344_2101 1/1 3504 3592 .. 1 94 [] 153.7 1.8e-43
CP001344_0795 1/1 736 824 .. 1 94 [] 152.3 4.8e-43
CP001344_1918 1/1 741 825 .. 1 94 [] 152.2 5.2e-43
CP001344_0794 1/1 478 564 .. 1 94 [] 152.1 5.5e-43
CP001344_1151 1/1 1357 1443 .. 1 94 [] 151.1 1e-42
CP001344_2002 1/1 1473 1559 .. 1 94 [] 147.9 8.2e-42
CP001344_3461 1/1 984 1072 .. 1 94 [] 142.3 3.4e-40
CP001344_3623 1/1 411 499 .. 1 94 [] 140.2 1.3e-39
CP001344_3234 1/1 388 474 .. 1 94 [] 136.6 1.3e-38
CP001344_3858 1/1 700 784 .. 1 94 [] 133.8 8.8e-38
CP001344_4021 1/1 2489 2575 .. 1 94 [] 131.6 3.6e-37
CP001344_3857 1/1 584 668 .. 1 94 [] 123.1 9.6e-35
CP001344_4148 1/1 563 649 .. 1 94 [] 121.3 3.1e-34
CP001344_3860 1/1 716 802 .. 1 94 [] 118.5 2e-33
CP001344_4776 1/1 254 340 .. 1 94 [] 108.0 1.9e-30
CP001344_3859 1/1 847 933 .. 1 94 [] 107.1 3.4e-30
CP001344_4022 1/1 139 227 .. 1 94 [] 102.3 7.9e-29
CP001344_2102 1/1 139 223 .. 1 94 [] 99.0 6.9e-28

Alignments of top-scoring domains:
CP001344_2101: domain 1 of 1, from 3504 to 3592: score 153.7, E = 1.8e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQv+SSLL+LQa+ ++d+ + +++L++sq RV++
CP001344_2 3504 EIHHRIKNNLQVVSSLLMLQADTTDDPYT-----QKVLQDSQERVAA 3545

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE LY+s dl+++d+seY++ L+e++f sy+++ gi L l+l
CP001344_2 3546 IALVHEALYRSADLERIDLSEYVQDLLEQIFYSYQGSERGIVLQLEL 3592

CP001344_0795: domain 1 of 1, from 736 to 824: score 152.3, E = 4.8e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvISSLLrLQ++++ d+ v + L++sqnRV++
CP001344_0 736 EVHHRVKNNLQVISSLLRLQSQRVNDPQV-----KTTLEDSQNRVMA 777

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+H+ LY+s+d+ +v+++ Y+ L+ +Lf+ ++ ++++i+L ++
CP001344_0 778 MALVHQNLYQSDDFAQVNLAVYIHSLATHLFSVFAIERSRIDLQIEV 824

CP001344_1918: domain 1 of 1, from 741 to 825: score 152.2, E = 5.2e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++SSLL+LQa+ ++d+++ l +L+Esq R+ +
CP001344_1 741 EIHHRVKNNLQIVSSLLMLQADTTTDPHA-----LSLLQESQERIYA 782

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE+LY+s l++vdfs+Y kL+e++f ++g+ + +++ l
CP001344_1 783 IALVHEYLYQSSTLSQVDFSAYAHKLAEQIFATWGHPKLKLH----L 825

CP001344_0794: domain 1 of 1, from 478 to 564: score 152.1, E = 5.5e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvISSLLrLQ++++ d+ v + L++sqnRV++
CP001344_0 478 EVHHRVKNNLQVISSLLRLQSQRVNDPQV-----KTTLEDSQNRVMA 519

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+H+ LY+s+d+ +v+++ Y+ L+ +Lf+ ++ ++++i+L +
CP001344_0 520 MALVHQNLYQSDDFAQVNLAVYIHSLATHLFSVFAIERSRIDLQ--I 564

CP001344_1151: domain 1 of 1, from 1357 to 1443: score 151.1, E = 1e-42
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++SSLL+LQ++ ++d+ v l++++Esq+R+ +
CP001344_1 1357 EIHHRVKNNLQIVSSLLMLQCDTVEDPQV-----LKLFQESQDRINA 1398

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A+iHE+LY+s +l +v++++Y+e L++++ s g ++i+L+ l
CP001344_1 1399 IAMIHEHLYQSSNLAQVNLKDYIESLVKQIVASIGNPQINIHLS--L 1443

CP001344_2002: domain 1 of 1, from 1473 to 1559: score 147.9, E = 8.2e-42
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++SSLL LQa k++d+ + +L+Esq R+ +
CP001344_2 1473 EIHHRVKNNLQIVSSLLELQAGKTSDPYA-----CSVLQESQERIYA 1514

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE+LYks +l++v+fs+Y + L+e+ f ++g+ + +++L l
CP001344_2 1515 IALVHEHLYKSPNLSQVNFSDYAQSLVEQVFLTWGRPNLKLHLA--L 1559

CP001344_3461: domain 1 of 1, from 984 to 1072: score 142.3, E = 3.4e-40
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvISSLL LQ+r+++ + + +++L++sqnRV++
CP001344_3 984 EVHHRVKNNLQVISSLLLLQSRRVDHPQA-----RAILEDSQNRVMA 1025

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+H+ LY++ ++ +v f+eY++ Lt++Lfqs +v+s+ + L ++
CP001344_3 1026 MSLVHQNLYQTHNFAQVGFAEYVRTLTNYLFQSLNVQSEQVTLHTEI 1072

CP001344_3623: domain 1 of 1, from 411 to 499: score 140.2, E = 1.3e-39
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQv+SSLL+LQa+ ++d + + +L+Esq RV++
CP001344_3 411 EIHHRIKNNLQVVSSLLMLQAETTDDIYT-----QQVLQESQERVMA 452

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE LYks+ l+++d+seY++ L+e++f s+ + gi+L l+l
CP001344_3 453 IALVHEALYKSDTLERIDLSEYIQDLLEEIFYSHHARQRGIQLGLEL 499

CP001344_3234: domain 1 of 1, from 388 to 474: score 136.6, E = 1.3e-38
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISS+LrLQ+r+++ + + +L+EsqnRV++
CP001344_3 388 EIHHRVKNNLQVISSMLRLQSRRTEIPQL-----KTILEESQNRVMA 429

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+HE LY++ d +v ++eY+ L+++Lf ++ + d i+L +
CP001344_3 430 MSLVHENLYRTPDCAQVRLREYVADLVRHLFGVFSAQLDQIDLQ--I 474

CP001344_3858: domain 1 of 1, from 700 to 784: score 133.8, E = 8.8e-38
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvI SLLrLQ ++kd + +L++s nR+lS
CP001344_3 700 EVHHRVKNNLQVICSLLRLQKNRIKDAQI-----SSVLEDSNNRILS 741

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+H+ LY+s ++ +v++++Y++ L+ +L+qsyg++s+ ++ +
CP001344_3 742 MALVHQSLYESQNFAQVNLADYVQALLQSLLQSYGGRSGQVN----T 784

CP001344_4021: domain 1 of 1, from 2489 to 2575: score 131.6, E = 3.6e-37
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNL +++SLL+LQa +++d+ + l++L++s+ R+++
CP001344_4 2489 EIHHRVKNNLEMVASLLMLQAGNTEDPYI-----LKLLKDSEERIAA 2530

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE+LY+s +l+++ + eY+++L+e++f+sy+ + ++L l
CP001344_4 2531 IALVHEYLYQSPNLGRIALNEYIRNLVEQIFSSYATSQLELKLA--L 2575

CP001344_3857: domain 1 of 1, from 584 to 668: score 123.1, E = 9.6e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvI SLLrLQ +++ + ++L++s nR+lS
CP001344_3 584 EVHHRVKNNLQVICSLLRLQKNRISVPQL-----AAVLEDSNNRILS 625

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+H+ LY+s+ + +v + +Y++ L L+qsyg++s+ i+ +
CP001344_3 626 MALVHQNLYESKKFAQVQLNDYVQSLMQALLQSYGGRSGQIK----T 668

CP001344_4148: domain 1 of 1, from 563 to 649: score 121.3, E = 3.1e-34
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHR KNNL +++SLL+LQa+k++d v + +L+Esq R+ +
CP001344_4 563 ETHHRLKNNLEIVASLLMLQADKTEDTYV-----RSILQESQERIYA 604

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE+LYks +l++vdfs+Y ++L+e f ++g +s +++L+ l
CP001344_4 605 IALVHEHLYKSSNLSQVDFSAYARNLVEKVFITWGNSSLHLHLS--L 649

CP001344_3860: domain 1 of 1, from 716 to 802: score 118.5, E = 2e-33
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvI SLLrLQ ++ d+++ + +L++s nR+lS
CP001344_3 716 EVHHRVKNNLQVICSLLRLQKNRTHDQDI-----ITVLEDSNNRILS 757

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+H+ LY+s ++ +v++++Y+ L +L+q yg ++ +++ +
CP001344_3 758 MALVHQNLYESNNFAQVNLAAYVHDLMQSLIQGYGSQRVQTQID--I 802

CP001344_4776: domain 1 of 1, from 254 to 340: score 108.0, E = 1.9e-30
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHR+KNNLQ+ +SLL LQa+ + + v + +L++ +nRV++
CP001344_4 254 EAHHRIKNNLQLLISLLELQAEMVNEAPV-----QSILQDNRNRVMA 295

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA+iHE L s+ l +dfs+Y+ L+++Lf+s++ s++++L+ +
CP001344_4 296 MATIHESLQGSDRLTEIDFSDYIYSLAAELFHSFNIPSQDLQLE--V 340

CP001344_3859: domain 1 of 1, from 847 to 933: score 107.1, E = 3.4e-30
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvI SLLrLQ + d + +L++s +R+lS
CP001344_3 847 EVHHRVKNNLQVICSLLRLQKNRMNDTQL-----ISILEDSNSRILS 888

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+H+ LY+s ++ +v++ +Y+ L+++L+q yg ++ ++ +
CP001344_3 889 MALVHQNLYESSNFAQVNLTAYVHDLVRSLIQGYGNERVQTQIQ--I 933

CP001344_4022: domain 1 of 1, from 139 to 227: score 102.3, E = 7.9e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRV+NNLQ+I SLL+LQ+ k++d+ + aL EsqnR+l+
CP001344_4 139 EVEHRVRNNLQLILSLLNLQSNKTSDPQL-----RSALAESQNRILT 180

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl H+ Y + ++++s+Yl++L +L ++ + ++d i L +++
CP001344_4 181 MALAHQISYADTKVADINLSQYLRNLGQHLYHALSISADQIALQFEI 227

CP001344_2102: domain 1 of 1, from 139 to 223: score 99.0, E = 6.9e-28
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ H VKNNLQvISSLL+LQ ++++++v ++aL sqnRVl+
CP001344_2 139 EVEHQVKNNLQVISSLLNLQINRTTNPDV-----RAALIASQNRVLA 180

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA+ H++ +++ +v + +Yl++L+e L+ s++ +s +i +
CP001344_2 181 MAIAHQHIDPDRNVTRVTLLPYLRELVERLMYSFAISSTNIG----C 223


Histogram of all scores:
score obs exp (one = represents 23 sequences)
----- --- ---
-15 15 0|=
-14 34 0|==
-13 105 31|=*===
-12 361 326|==============*=
-11 1323 908|=======================================*==================
-10 947 1175|========================================== *
-9 827 992|==================================== *
-8 557 665|========================= *
-7 274 395|============ *
-6 271 220|=========*==
-5 102 118|=====*
-4 56 62|==*
-3 37 32|=*
-2 16 17|*
-1 14 8|*
0 4 4|*
1 1 2|*
2 1 1|*
3 2 0|=
4 0 0|
5 0 0|
> 6 19 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 514.1478
P(chi-square) = 0

Total sequences searched: 4966

Whole sequence top hits:
tophits_s report:
Total hits: 18
Satisfying E cutoff: 18
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 18
Satisfying E cutoff: 18
Total memory: 28K


Acknowledgements:

This research is funded by:

Developed by: