Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
39 projects found  

4 accessions found for Cyanothece sp. PCC 7425  

Data for CP001344  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001344.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001344_2982 CDS_3211711-3212922 98.5 1.1e-28 1
CP001344_1700 CDS_1811316-1813274 81.5 1.2e-23 1
CP001344_1180 CDS_1236304-1237545 69.7 3.6e-20 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001344_2982 1/1 200 267 .. 1 70 [] 98.5 1.1e-28
CP001344_1700 1/1 452 519 .. 1 70 [] 81.5 1.2e-23
CP001344_1180 1/1 214 281 .. 1 70 [] 69.7 3.6e-20

Alignments of top-scoring domains:
CP001344_2982: domain 1 of 1, from 200 to 267: score 98.5, E = 1.1e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HDs+g++L++ +l+l++a+rll ++dpeea + l+e+
CP001344_2 200 ERNRIAREIHDSLGHHLTVFNLHLSAALRLL--PTDPEEAIALLEEV 244

relarealaevRrllgdLRpaal<-*
++l+ +al+evR+ +g+LR++ l
CP001344_2 245 KQLGATALQEVRQSVGQLRTDPL 267

CP001344_1700: domain 1 of 1, from 452 to 519: score 81.5, E = 1.2e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA ++HD+++Q++++i+lqle+a+ l+ + +p+ +++ l+ i
CP001344_1 452 ERNRIASDIHDTLAQAFTGISLQLEVAKPLI--QQEPQTVEQILQHI 496

relarealaevRrllgdLRpaal<-*
+la+ +lae+Rr +++L p++
CP001344_1 497 SQLAKNGLAEARRSVWALYPPGT 519

CP001344_1180: domain 1 of 1, from 214 to 281: score 69.7, E = 3.6e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD +g++L+a ++qle a+ l ++++++ + l+e+
CP001344_1 214 ERNRIAREIHDALGHTLTAQSIQLENALLFL--PAEAQKSASFLQEA 258

relarealaevRrllgdLRpaal<-*
r+l+ +al+evRr + +LR l
CP001344_1 259 RQLGARALQEVRRSIATLRSNPL 281


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-15 1 0|=
-14 29 0|==
-13 102 0|=======
-12 164 55|===*=======
-11 289 455|==================== *
-10 749 1056|================================================== *
-9 835 1199|======================================================== *
-8 722 924|================================================= *
-7 679 581|======================================*=======
-6 443 328|=====================*========
-5 415 176|===========*================
-4 187 92|======*======
-3 126 47|===*=====
-2 87 24|=*====
-1 49 12|*===
0 32 6|*==
1 21 3|*=
2 17 1|*=
3 5 0|=
4 3 0|=
5 7 0|=
> 6 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1502.4259
P(chi-square) = 0

Total sequences searched: 4966

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: