Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
39 projects found  

4 accessions found for Cyanothece sp. PCC 7425  

Data for CP001345  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001345.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001345_0145 CDS_188382-186739 159.0 1.9e-46 1
CP001345_0001 CDS_2252-54 149.8 7.9e-44 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001345_0145 1/1 343 429 .. 1 94 [] 159.0 1.9e-46
CP001345_0001 1/1 529 617 .. 1 94 [] 149.8 7.9e-44

Alignments of top-scoring domains:
CP001345_0145: domain 1 of 1, from 343 to 429: score 159.0, E = 1.9e-46
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++SSLL+LQ++ ++d+ v ++L+Esq R++S
CP001345_0 343 EIHHRVKNNLQIVSSLLMLQSDTITDPYV-----TKVLQESQERIQS 384

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE+LY s +l+++dfs+Y+ekL+++Lf ++g + +++++ l
CP001345_0 385 IALVHEHLYSSPNLSQIDFSSYIEKLVKSLFTTWGNPNLKLHFD--L 429

CP001345_0001: domain 1 of 1, from 529 to 617: score 149.8, E = 7.9e-44
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNL v+SSLL+LQ++ ++d + l++L+Esq+R+++
CP001345_0 529 EIHHRVKNNLTVVSSLLNLQSETTQDALA-----LKLLQESQDRIAT 570

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE LY+s +l+++++++Yl++Lte++f++y+ + +++L+lD
CP001345_0 571 IALVHELLYQSPSLERIEVDQYLKRLTEQIFSTYSSQHLRLHLDLDA 617


Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-15 2 0|==
-14 1 0|=
-13 8 1|*=======
-12 11 10|=========*=
-11 42 29|============================*=============
-10 17 37|================= *
-9 27 31|=========================== *
-8 17 21|================= *
-7 16 12|===========*====
-6 9 7|======*==
-5 2 3|==*
-4 2 2|=*
-3 3 1|*==
> -2 3 -|===


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 20.1113
P(chi-square) = 0.002646

Total sequences searched: 160

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: