Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

8 accessions found for Methylobacterium nodulans ORS 2060  

Data for CP001349  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001349.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001349_1890 CDS_2062060-2063208 108.2 2.4e-30 1
CP001349_0316 CDS_368195-369391 93.6 3.5e-26 1
CP001349_6427 CDS_6807127-6808290 89.8 4.1e-25 1
CP001349_6363 CDS_6742313-6744532 76.2 3.1e-21 1
CP001349_4003 CDS_4234555-4235580 66.9 1.4e-18 1
CP001349_1616 CDS_1768219-1769265 56.8 1e-15 1
CP001349_6788 CDS_7173710-7174783 51.2 3.9e-14 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001349_1890 1/1 191 275 .. 1 94 [] 108.2 2.4e-30
CP001349_0316 1/1 209 291 .. 1 94 [] 93.6 3.5e-26
CP001349_6427 1/1 192 278 .. 1 94 [] 89.8 4.1e-25
CP001349_6363 1/1 547 627 .. 1 94 [] 76.2 3.1e-21
CP001349_4003 1/1 151 234 .. 1 94 [] 66.9 1.4e-18
CP001349_1616 1/1 157 244 .. 1 94 [] 56.8 1e-15
CP001349_6788 1/1 166 250 .. 1 94 [] 51.2 3.9e-14

Alignments of top-scoring domains:
CP001349_1890: domain 1 of 1, from 191 to 275: score 108.2, E = 2.4e-30
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L++++SLL LQ r +++e+v + aL ++q+RV +
CP001349_1 191 EMSHRVKNSLAIVASLLTLQGRAADNEDV-----RRALADAQSRVEA 232

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++L++ dl vd++++le L+e L +s+ +++ + +
CP001349_1 233 VAQVHDQLWRQPDLAAVDIAPFLETLCERLADSAPNHAIRCR----I 275

CP001349_0316: domain 1 of 1, from 209 to 291: score 93.6, E = 3.5e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L v+++LLrLQar + +eev + aL+++ R+++
CP001349_0 209 EMSHRVKNSLGVVAGLLRLQARDTHSEEV-----RYALEDAGARIAT 250

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++L+++ ++tv++s ++++L++ L +++ + + +
CP001349_0 251 VAQVHDHLWRGLHVGTVEVSGFVRELVSKLQEAAPGHPLR------C 291

CP001349_6427: domain 1 of 1, from 192 to 278: score 89.8, E = 4.1e-25
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+LQ++SS+L LQar+ ++ +aL E+ +RV+S
CP001349_6 192 EVDHRVKNSLQLVSSMLTLQARQLPTGDA-----AKALDEACRRVAS 233

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A HE+LY+ d+vd+s +l+ ++e L + +gi+++
CP001349_6 234 VAAAHEQLYRATASDRVDMSVFLRGICEALAATRPSNVEGIEIR--A 278

CP001349_6363: domain 1 of 1, from 547 to 627: score 76.2, E = 3.1e-21
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L++IS+LL LQar + + + aL+E+ +RV +
CP001349_6 547 EVSHRVKNSLALISGLLTLQARPLGGAA------RRALEEASQRVHA 587

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H++L+++ ++ ++d++++l L++ ++ + s +
CP001349_6 588 VARVHDQLWRGAGTRDIDLRPFLCDLCSAVGTTAPRHST-------V 627

CP001349_4003: domain 1 of 1, from 151 to 234: score 66.9, E = 1.4e-18
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRV+NNLQv+ SL+ L r + +e + + a+ +RV++
CP001349_4 151 EVYHRVRNNLQVMVSLIGLYGRAAPGE-C-----RPAFDALGQRVRA 191

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al++++L++ + ++d++eYle+L + L q + g++ ++ +
CP001349_4 192 IALVQQHLHEAPAIASIDLAEYLERLGHGLSQMRRAGRIVVD----V 234

CP001349_1616: domain 1 of 1, from 157 to 244: score 56.8, E = 1e-15
*->EIHHRVKNNLQvISSLLrLQarkfkd..eevikdEVleaLrEsqnRV
E +HRV N++Q +++LL LQ r++ +++++ l+aL E++ RV
CP001349_1 157 ELQHRVANSMQFVAALLALQKRQAAHdpQAA-----LNALDEARLRV 198

lSmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<
mA iH++LY +l++ +++Yl++++++L+++ g + +++ +
CP001349_1 199 ELMARIHRRLYDPASLER-PIGAYLQEICSDLLDATGARTVICRVE--M 244

-*

CP001349_1 - -

CP001349_6788: domain 1 of 1, from 166 to 250: score 51.2, E = 3.9e-14
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HR KN LQvI+SLL+L ar+ d ++ +++L RV +
CP001349_6 166 ELDHRAKNTLQVIASLLMLRARRGPDAAT-----RAILDRMAERVGA 207

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
A +++ + d + +d++ + e+++++L+ gv+ ++i +++++
CP001349_6 208 LAAVQRL--GGPDDGCLDLRVFAEEMAGELLA--GVEPGRITVSVEV 250


Histogram of all scores:
score obs exp (one = represents 38 sequences)
----- --- ---
-15 45 0|==
-14 115 0|====
-13 213 46|=*====
-12 613 483|============*====
-11 2233 1345|===================================*=======================
-10 1543 1740|========================================= *
-9 986 1470|========================== *
-8 748 986|==================== *
-7 355 585|========== *
-6 276 326|========*
-5 115 175|====*
-4 43 93|==*
-3 28 48|=*
-2 10 25|*
-1 16 13|*
0 3 6|*
1 0 3|*
> 2 14 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 1631.0681
P(chi-square) = 0

Total sequences searched: 7356

Whole sequence top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: