Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

8 accessions found for Methylobacterium nodulans ORS 2060  

Data for CP001349  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001349.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001349_6248 CDS_6618202-6619236 133.9 3.5e-45 1
CP001349_0926 CDS_1031938-1034490 127.1 7.3e-43 1
CP001349_5681 CDS_6024407-6022602 124.9 3.9e-42 1
CP001349_6176 CDS_6543860-6541953 110.2 4.2e-37 1
CP001349_3609 CDS_3871670-3868479 75.4 2.9e-25 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001349_6248 1/1 149 231 .. 1 85 [] 133.9 3.5e-45
CP001349_0926 1/1 628 714 .. 1 85 [] 127.1 7.3e-43
CP001349_5681 1/1 397 484 .. 1 85 [] 124.9 3.9e-42
CP001349_6176 1/1 434 517 .. 1 85 [] 110.2 4.2e-37
CP001349_3609 2/2 863 946 .. 1 85 [] 74.5 6e-25

Alignments of top-scoring domains:
CP001349_6248: domain 1 of 1, from 149 to 231: score 133.9, E = 3.5e-45
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ++ ++R+a+s+def ++Fs+R +L+ +H+L
CP001349_6 149 ELHHRVKNTLATVQALLGASARSATSVDEFYQSFSDRVISLAKTHNL 195

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt++ W++A+L e le eL+Py++e++eRi l+GP+
CP001349_6 196 --LTDDYWQMASLQEMLENELGPYNDEAGERIALDGPP 231

CP001349_0926: domain 1 of 1, from 628 to 714: score 127.1, E = 7.3e-43
*->ELnHRVKNtLAvVQSiarQTlR..naasldefveaFsgRLqALsraH
ELnHRVKNtLA+VQSia Q+lR+ + + ++++eaF +RL+AL+raH
CP001349_0 628 ELNHRVKNTLATVQSIAMQSLRrlRGKEAEDAREAFVARLVALARAH 674

dLVpLtrseWagAdLreLleaeLaPygge.d.aeRitlsGPd<-*
d+ Ltr++W+gA+L+e+++ ++aP +g+++++ R+ +sGP+
CP001349_0 675 DV--LTRESWEGAELAEVVAGAVAPLEGPrGrRARFSISGPP 714

CP001349_5681: domain 1 of 1, from 397 to 484: score 124.9, E = 3.9e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ+i+ T+R+a s+++f eaF gR+++L+ +H++
CP001349_5 397 ELHHRVKNTLATVQAIVGSTARTASSIESFYEAFVGRIMSLAHTHSV 443

VpLtrseWagAdLreLleaeLaPygged.....aeRitlsGPd<-*
Lt++ W+ A+Lr Lle eL Py++ +++ ++Ritl+GP+
CP001349_5 444 --LTEDVWQTASLRGLLENELTPYADGPmtpeaDGRITLEGPA 484

CP001349_6176: domain 1 of 1, from 434 to 517: score 110.2, E = 4.2e-37
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+++vV Sia+QTl +++sl++f+++F +RL+ALsr+++L
CP001349_6 434 ELQHRTRNLITVVRSIAQQTLATSPSLEAFRTQFNDRLAALSRVQGL 480

VpLtrseWagAdLreLleaeLaPygged.aeRitlsGPd<-*
L+r++ +++++r+L++ eL++ g+++ +eRi+l+GP+
CP001349_6 481 --LSRADQEPVTIRALIQTELDALGAAGmQERIVLDGPP 517

CP001349_3609: domain 2 of 2, from 863 to 946: score 74.5, E = 6e-25
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+NtLAv Si+r T+ ++++++ f++ ++gR+ A +r++
CP001349_3 863 ELQHRVRNTLAVLRSIVRRTAATSDTVEVFAAHLEGRIDAFARVQAA 909

VpLtrseWagAdLreLleaeLaPyggedaeRit.lsGPd<-*
+tr+ +ag dL +L+++eL ++ ++ +++++++ GP+
CP001349_3 910 --VTRDPAAGIDLEQLVSHELLAHVAHEGDQVRsIAGPS 946


Histogram of all scores:
score obs exp (one = represents 22 sequences)
----- --- ---
-14 26 0|==
-13 144 0|=======
-12 577 0|===========================
-11 701 60|==*=============================
-10 922 760|==================================*=======
-9 1296 1882|==========================================================*
-8 1264 1954|==========================================================*
-7 938 1313|=========================================== *
-6 590 716|=========================== *
-5 369 355|================*
-4 238 168|=======*===
-3 115 78|===*==
-2 65 35|=*=
-1 39 16|*=
0 19 7|*
1 27 3|*=
2 8 1|*
3 3 0|=
4 1 0|=
5 3 0|=
> 6 11 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 7541.5767
P(chi-square) = 0

Total sequences searched: 7356

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: