hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001353.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001353_0012 CDS_8483-9499 45.2 1.3e-14 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001353_0012 1/1 142 229 .. 1 94 [] 45.2 1.3e-14
Alignments of top-scoring domains:
CP001353_0012: domain 1 of 1, from 142 to 229: score 45.2, E = 1.3e-14
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HR++N L + +L+ LQ r ++de + ++ L + +R +
CP001353_0 142 EASHRIRNDLTTLMALVKLQYRTVQDETA-----RAMLAATADRMQV 183
mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
A +HE+L + + tv e+l+ L+++L+ s+ + + + +++++
CP001353_0 184 LARVHERLRRDTSKTTVGSYEFLSGLCNDLRTSMIGLRPVV-IRAEV 229
Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-14 1 0|=
-13 3 0|===
-12 8 3|==*=====
-11 19 8|=======*===========
-10 5 11|===== *
-9 4 9|==== *
-8 4 6|==== *
-7 0 3| *
-6 1 2|=*
> -5 3 -|===
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 15.4615
P(chi-square) = 8.42e-05
Total sequences searched: 48
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K