Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

1 accessions found for Chloroflexus sp. Y-400-fl  

Data for CP001364  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001364.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001364_3413 CDS_4343885-4346080 94.0 2.1e-27 1
CP001364_0694 CDS_892202-893602 81.0 1.4e-23 1
CP001364_3612 CDS_4602161-4604536 79.2 4.9e-23 1
CP001364_0699 CDS_899083-897845 73.5 2.4e-21 1
CP001364_0955 CDS_1254316-1252523 68.4 7.2e-20 1
CP001364_0742 CDS_949191-947554 66.6 2.6e-19 1
CP001364_1396 CDS_1808697-1807636 66.3 3e-19 1
CP001364_0021 CDS_24418-25893 62.6 3.7e-18 1
CP001364_2780 CDS_3502765-3503790 59.3 3.5e-17 1
CP001364_1489 CDS_1927991-1930003 56.2 2.9e-16 3
CP001364_2037 CDS_2650297-2648705 54.9 6.8e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001364_3413 1/1 522 589 .. 1 70 [] 94.0 2.1e-27
CP001364_0694 1/1 261 328 .. 1 70 [] 81.0 1.4e-23
CP001364_3612 1/1 179 246 .. 1 70 [] 79.2 4.9e-23
CP001364_0699 1/1 213 280 .. 1 70 [] 73.5 2.4e-21
CP001364_0955 1/1 391 458 .. 1 70 [] 68.4 7.2e-20
CP001364_0742 1/1 338 405 .. 1 70 [] 66.6 2.6e-19
CP001364_1396 1/1 150 217 .. 1 70 [] 66.3 3e-19
CP001364_0021 1/1 281 346 .. 1 70 [] 62.6 3.7e-18
CP001364_2780 1/1 137 205 .. 1 70 [] 59.3 3.5e-17
CP001364_2037 1/1 317 382 .. 1 70 [] 54.9 6.8e-16
CP001364_1489 3/3 469 524 .. 1 58 [. 49.8 2.3e-14

Alignments of top-scoring domains:
CP001364_3413: domain 1 of 1, from 522 to 589: score 94.0, E = 2.1e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHDsv+Q+L++++l +++ar ++ +++p+++ + ld++
CP001364_3 522 ERNRLARELHDSVSQQLFSMTLTAQAARSQF--ERNPARVPALLDRL 566

relarealaevRrllgdLRpaal<-*
+e+a alae+R+l+ +LRp+al
CP001364_3 567 HETATAALAEMRALIFQLRPPAL 589

CP001364_0694: domain 1 of 1, from 261 to 328: score 81.0, E = 1.4e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD+v+QsL+ +++ ++l + l + +pe++re++++
CP001364_0 261 ERTRIARDLHDGVAQSLAFMRMRIDLWEDWL--TQEPERLREEFATF 305

relarealaevRrllgdLRpaal<-*
++ +r+ ++e+Rr++ +LRp +
CP001364_0 306 KANLRRQIEELRRAIFALRPIEI 328

CP001364_3612: domain 1 of 1, from 179 to 246: score 79.2, E = 4.9e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR+LHD++ Q+L++i++ + +a+ l+ ++dp a+++++ +
CP001364_3 179 ERNRLARDLHDTIKQQLFSINIAAATAQSLY--ERDPVGAAQHIQHV 223

relarealaevRrllgdLRpaal<-*
r+l++ a+ae+ +ll++LRp+ l
CP001364_3 224 RDLSQAAMAEMKALLTQLRPQPL 246

CP001364_0699: domain 1 of 1, from 213 to 280: score 73.5, E = 2.4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+A E+HD++g++L+a+ +ql++a+rll + dp +a++al+ +
CP001364_0 213 ERVRLAHEIHDGLGHHLTALHVQLQVAARLL--EHDPVRAAQALHLC 257

relarealaevRrllgdLRpaal<-*
re+a+ al+evR+ + +R l
CP001364_0 258 REAAQAALTEVRQSVAIMRSNPL 280

CP001364_0955: domain 1 of 1, from 391 to 458: score 68.4, E = 7.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ +AR+LHD+ +Q++++i++++e ++rll ++dp++a ++lde+
CP001364_0 391 VRHQLARDLHDGPAQAMAVITMKAEFIKRLL--ERDPAQALAELDEL 435

relarealaevRrllgdLRpaal<-*
+a+++ evR +l +LRp l
CP001364_0 436 SSIAKRTNYEVRTMLFELRPLML 458

CP001364_0742: domain 1 of 1, from 338 to 405: score 66.6, E = 2.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IAR+LHD+ Qs++ai++ +e ++rl+ ++ pe++ ++ld++
CP001364_0 338 VRHAIARDLHDGPTQSIAAIAMNIEFIKRLF--KAMPERVPAELDTL 382

relarealaevRrllgdLRpaal<-*
+el++++ ++R ll +LRp +l
CP001364_0 383 AELVQKTTHDIRTLLFELRPLGL 405

CP001364_1396: domain 1 of 1, from 150 to 217: score 66.3, E = 3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI+ +HD+ +Q++s + l +e ++rll d+d ++ar++l ++
CP001364_1 150 ERLRISLQMHDGPAQAMSNLVLRAEICQRLL--DRDLDQARAELVAL 194

relarealaevRrllgdLRpaal<-*
+++++ +l+e+R + dLRp++l
CP001364_1 195 KTAVNNTLQETRKFIFDLRPMTL 217

CP001364_0021: domain 1 of 1, from 281 to 346: score 62.6, E = 3.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHDs +Q+L+++ ++l ++ + +++ e+++++d +
CP001364_0 281 ERKRIARELHDSTSQALTSLLVGLRSLADRH--RSP--EIAQQVDDL 323

relarealaevRrllgdLRpaal<-*
r ++ + l+++ +l+++LRp++l
CP001364_0 324 RSIVGQILNDLHALARQLRPSVL 346

CP001364_2780: domain 1 of 1, from 137 to 205: score 59.3, E = 3.5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARE HD+ +Q L+ + +++e+++ ll+ + + +++ l ++
CP001364_2 137 ERIRLAREVHDGPAQVLANALMGVEVCQNLLQ-EQHLDRLGSILSQL 182

relarealaevRrllgdLRpaal<-*
+ +re+l+evR + dLRp+ l
CP001364_2 183 GDSVREGLREVRSFIADLRPGKL 205

CP001364_2037: domain 1 of 1, from 317 to 382: score 54.9, E = 6.8e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD v Q L + + qle ++ + d + + e+l+ i
CP001364_2 317 ERKALARELHDQVIQDLLSFNYQLEHVEEEI--DQE--SILEELQHI 359

relarealaevRrllgdLRpaal<-*
r+ +re a +R++ +dLRp++l
CP001364_2 360 RRGIREVVAMLRQMCSDLRPPTL 382

CP001364_1489: domain 3 of 3, from 469 to 524: score 49.8, E = 2.3e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R ARE+HD +g L +i+l l+la+ l+ ++dp +ar++l+
CP001364_1 469 ERSRFAREMHDDLGSKLVLINLELQLAADLA--TEDPTAARDHLAHS 513

relarealaev<-*
rel++ a + +
CP001364_1 514 RELLHSAWQSL 524


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 13 0|==
-13 53 0|=====
-12 77 46|====*==
-11 131 381|============ *
-10 422 884|======================================= *
-9 600 1004|======================================================= *
-8 557 774|=================================================== *
-7 585 486|============================================*=========
-6 488 275|========================*====================
-5 477 147|=============*==============================
-4 247 77|======*================
-3 173 39|===*============
-2 129 20|=*==========
-1 73 10|*======
0 40 5|*===
1 30 2|*==
2 22 1|*=
3 12 0|==
4 5 0|=
5 3 0|=
6 2 0|=
7 4 0|=
8 1 0|=
9 1 0|=
10 1 0|=
> 11 13 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3584.4819
P(chi-square) = 0

Total sequences searched: 4159

Whole sequence top hits:
tophits_s report:
Total hits: 11
Satisfying E cutoff: 11
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 11
Satisfying E cutoff: 11
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: