Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Rhizobium sp. NGR234  

Data for CP001389  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001389.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001389_3007 CDS_3225737-3224673 102.3 5.6e-29 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001389_3007 1/1 156 242 .. 1 94 [] 102.3 5.6e-29

Alignments of top-scoring domains:
CP001389_3007: domain 1 of 1, from 156 to 242: score 102.3, E = 5.6e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRV N+LQ+I+S+L+L ar + +ee+ +++L+++++RV+S
CP001389_3 156 ELQHRVANSLQIIASILMLKARAVNSEET-----RDHLEDARQRVMS 197

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A ++++L s +d+v++++Yl+kL+ +L +s+ +g++ i +k +
CP001389_3 198 VAAVQQHLNSSAAVDKVEVGPYLSKLCQSLAESMIGGREPIAVK--V 242


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-15 8 0|=
-14 17 0|=
-13 59 22|=*==
-12 202 238|============ *
-11 992 664|=======================================*===================
-10 811 859|================================================ *
-9 575 726|================================== *
-8 419 487|========================= *
-7 205 289|============= *
-6 188 161|=========*==
-5 68 86|==== *
-4 36 45|==*
-3 25 24|=*
-2 10 12|*
-1 4 6|*
0 4 3|*
1 2 1|*
> 2 8 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 304.5596
P(chi-square) = 0

Total sequences searched: 3633

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: