Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
3 projects found  

1 accessions found for Acidobacterium capsulatum ATCC 51196  

Data for CP001472  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001472.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001472_1026 CDS_1237556-1236465 84.7 9.6e-25 1
CP001472_2012 CDS_2470804-2473881 83.2 2.6e-24 1
CP001472_3372 CDS_4113715-4111574 60.2 1.5e-17 1
CP001472_1231 CDS_1537362-1540268 53.1 1.9e-15 1
CP001472_1265 CDS_1578154-1581390 42.6 2.5e-12 1
CP001472_1261 CDS_1576045-1573082 34.6 5.6e-10 1
CP001472_0668 CDS_799120-800925 30.7 8e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001472_1026 1/1 167 234 .. 1 70 [] 84.7 9.6e-25
CP001472_2012 1/1 820 888 .. 1 70 [] 83.2 2.6e-24
CP001472_3372 1/1 490 556 .. 1 70 [] 60.2 1.5e-17
CP001472_1231 1/1 759 826 .. 1 70 [] 53.1 1.9e-15
CP001472_1265 1/1 868 934 .. 1 70 [] 42.6 2.5e-12
CP001472_1261 1/1 772 839 .. 1 70 [] 34.6 5.6e-10
CP001472_0668 1/1 399 464 .. 1 70 [] 30.7 8e-09

Alignments of top-scoring domains:
CP001472_1026: domain 1 of 1, from 167 to 234: score 84.7, E = 9.6e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD +g++Ls++ l++ela r + d+d e+ar++++e+
CP001472_1 167 ERERIARDLHDLLGHTLSVVVLKAELAGRYF--DRDHERARQEIAEV 211

relarealaevRrllgdLRpaal<-*
+ ++r+al++vR++++++R ++l
CP001472_1 212 ESISRQALQQVREAVTGFRMQGL 234

CP001472_2012: domain 1 of 1, from 820 to 888: score 83.2, E = 2.6e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+++Q+++a+++qle++ rll + + e ar ald++
CP001472_2 820 ERTRIAREIHDTLAQGFAAVSVQLEVVSRLL--PNATEGARHALDTA 864

relarealaevRrllgdLR.paal<-*
r lar +l+++R ++dLR+ + +
CP001472_2 865 RSLARSSLQDARTSIWDLRsQSSE 888

CP001472_3372: domain 1 of 1, from 490 to 556: score 60.2, E = 1.5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER R+A E+HD+++Qs+++i qle++r d+ p++++ar++l
CP001472_3 490 ERGRLAHEMHDTLAQSFAGIGFQLEALR-----DELPDqgAARTHLN 531

eirelarealaevRrllgdLRpaal<-*
+r+l+r + +e+Rr + LRp l
CP001472_3 532 IARDLVRYSHEEARRNIASLRPENL 556

CP001472_1231: domain 1 of 1, from 759 to 826: score 53.1, E = 1.9e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA +HD+v Q + +++lqlel+ ++ ++ pe ++l+e+
CP001472_1 759 ERERIAYQIHDTVIQDMIGATLQLELIGFQI--AEQPETSGKTLAEL 803

relarealaevRrllgdLRpaal<-*
++ re++a R+++++L+ +a
CP001472_1 804 AGRMRETIARSRNMVSNLHSTAV 826

CP001472_1265: domain 1 of 1, from 868 to 934: score 42.6, E = 2.5e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD++ QsL +++l +++ + + ++p+++r+ ++ +
CP001472_1 868 ERMRIARELHDTLLQSLQGLILSVSAFSAGA---TAPARVRDDMEGA 911

relarealaevRrllgdLRpaal<-*
+ a+e l R+ ++dLR ++l
CP001472_1 912 LDRAEELLVLGRDRIRDLRADDL 934

CP001472_1261: domain 1 of 1, from 772 to 839: score 34.6, E = 5.6e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD++ Q++ ++ l ++ ++ + e+re+l++
CP001472_1 772 ERMRIARELHDTLLQAMQGLVLSISSFSSQAV-VSS--EVREELERS 815

relarealaevRrllgdLR.paal<-*
++a++ l R+ ++dLR+++++
CP001472_1 816 LDHADRLLVSGRNRIRDLRgEGGE 839

CP001472_0668: domain 1 of 1, from 399 to 464: score 30.7, E = 8e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHDsv Q ++++l l+ + ++ + r al+
CP001472_0 399 ERRRIARELHDSVLQLHALLSLNLDKISS----ESLDRTSRNALEDT 441

relarealaevRrllgdLRpaal<-*
++l+ + +e+R + L+p+
CP001472_0 442 KALVTICSEELRTISYLLHPPFI 464


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 23 0|===
-13 43 0|=====
-12 76 37|===*====
-11 146 309|=============== *
-10 384 719|======================================= *
-9 572 816|==========================================================*
-8 495 629|================================================== *
-7 474 395|=======================================*========
-6 390 223|======================*================
-5 325 120|===========*=====================
-4 178 62|======*===========
-3 108 32|===*=======
-2 61 16|=*=====
-1 42 8|*====
0 24 4|*==
1 11 2|*=
2 6 1|*
3 7 0|=
4 3 0|=
5 2 0|=
6 1 0|=
7 1 0|=
8 1 0|=
9 1 0|=
10 0 0|
11 0 0|
> 12 8 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1516.4354
P(chi-square) = 0

Total sequences searched: 3382

Whole sequence top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: