Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

5 accessions found for Methylobacterium extorquens AM1  

Data for CP001510  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001510.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001510_4129 CDS_4574758-4577385 113.3 5.9e-32 1
CP001510_4958 CDS_5498868-5497822 109.2 8.5e-31 1
CP001510_4606 CDS_5109456-5108311 106.4 5.2e-30 1
CP001510_4085 CDS_4528850-4527795 90.6 1.7e-25 1
CP001510_0331 CDS_365021-363942 69.7 1.5e-19 1
CP001510_4229 CDS_4688135-4689151 68.6 3.1e-19 1
CP001510_3256 CDS_3638383-3637319 40.9 2.2e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001510_4129 1/1 685 768 .. 1 94 [] 113.3 5.9e-32
CP001510_4958 1/1 156 242 .. 1 94 [] 109.2 8.5e-31
CP001510_4606 1/1 191 272 .. 1 94 [] 106.4 5.2e-30
CP001510_4085 1/1 157 243 .. 1 94 [] 90.6 1.7e-25
CP001510_0331 1/1 157 240 .. 1 94 [] 69.7 1.5e-19
CP001510_4229 1/1 142 224 .. 1 94 [] 68.6 3.1e-19
CP001510_3256 1/1 163 211 .. 1 54 [. 40.9 2.2e-11

Alignments of top-scoring domains:
CP001510_4129: domain 1 of 1, from 685 to 768: score 113.3, E = 5.9e-32
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HRVKN+LQ++++ L +Q r++ d+e+ + a+ E+ RV+S
CP001510_4 685 EIDHRVKNSLQIVTAFLHMQRRQIADPEA-----RQAFSETSARVMS 726

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H+ LY++e++++vd+++ ++ L+++L +g++ + ++ l
CP001510_4 727 VARVHDSLYQGESMEQVDLGQTIQTLCSDLAGMAGDEHS---VE--L 768

CP001510_4958: domain 1 of 1, from 156 to 242: score 109.2, E = 8.5e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+L ++++L r+Q+ ++d+++ ++aL+E q R+ +
CP001510_4 156 EVNHRVANSLTLVAALARMQTNAVTDPAA-----KDALEEMQARISA 197

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A iH++LY+sed++ v++++Yl+ L+e+L ++ ++ ++ ++ l
CP001510_4 198 IAGIHRRLYTSEDVEAVELDAYLTGLVEELQLAMKASGRDHAIR--L 242

CP001510_4606: domain 1 of 1, from 191 to 272: score 106.4, E = 5.2e-30
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L+v+++LL LQar +++e+v + aL +++ RV +
CP001510_4 191 EMSHRVKNSLAVVAGLLALQARGTDNEDV-----KSALADARARVEA 232

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++L++ dl ++d++ +le L+e L +++g + +
CP001510_4 233 VAQVHDQLWRQPDLTRIDVAGFLEALCEKLTETAGAHAL-------V 272

CP001510_4085: domain 1 of 1, from 157 to 243: score 90.6, E = 1.7e-25
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKNNLQvISSL L ar++ + ++ ++aL+ +R+ +
CP001510_4 157 EVDHRVKNNLQVISSLMLLKARRTPEGDA-----RNALQAMADRIGA 198

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++ H++LY +d+ + df+e+ L+++L g+++d+ +++ ++
CP001510_4 199 LSTAHRMLYSEGDVTRFDFREFTADLIADLAA--GLDGDRTRIETEI 243

CP001510_0331: domain 1 of 1, from 157 to 240: score 69.7, E = 1.5e-19
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HRV+NNLQv+ SL+ L r + + + + + +RV++
CP001510_0 157 EIYHRVRNNLQVMVSLIGLYGRAAPEA-C-----RGSFDALGQRVRA 197

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al++++L++ + ++d+++Yl +L++ L q+ + g++g+ +
CP001510_0 198 IALVQQHLHEAPHIASIDLRDYLHRLASGLGQLRRAGRIGVT----V 240

CP001510_4229: domain 1 of 1, from 142 to 224: score 68.6, E = 3.1e-19
*->EIHHRVKNNLQvISSLLrLQarkfkd..eevikdEVleaLrEsqnRV
E +HRV NN+Q +++LL LQ rk+ d+++e+ +++ E+q R
CP001510_4 142 ELQHRVANNMQFVAALLALQKRKVIDnpQEA-----ADVFDEAQARL 183

lSmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<
+++A iH++LY + +++Yl++L+++L+++ g +++ +
CP001510_4 184 QTIARIHRRLYDPAR-ADQPVGQYLQELCSDLLDATGARNI-------V 224

-*

CP001510_4 - -

CP001510_3256: domain 1 of 1, from 163 to 211: score 40.9, E = 2.2e-11
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HR +N LQ+IS++L LQ+ ++ d++v ++aL E+++R+ +
CP001510_3 163 EIGHRARNDLQMISAMLTLQSGNSADPAV-----RAALGEAIGRIDA 204

mAliHEe<-*
++++++
CP001510_3 205 LSTLYRQ 211


Histogram of all scores:
score obs exp (one = represents 25 sequences)
----- --- ---
-15 31 0|==
-14 65 0|===
-13 170 31|=*=====
-12 415 326|=============*===
-11 1475 908|====================================*======================
-10 1007 1176|========================================= *
-9 708 993|============================= *
-8 474 666|=================== *
-7 254 395|=========== *
-6 181 220|========*
-5 66 118|=== *
-4 50 62|==*
-3 29 32|=*
-2 12 17|*
-1 9 8|*
0 7 4|*
1 0 2|*
2 1 1|*
3 2 0|=
4 2 0|=
> 5 12 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 1244.4667
P(chi-square) = 0

Total sequences searched: 4970

Whole sequence top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: