Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

5 accessions found for Methylobacterium extorquens AM1  

Data for CP001510  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001510.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001510_1476 CDS_1670713-1669235 141.2 7.4e-48 1
CP001510_0890 CDS_1005656-1002660 131.7 1.3e-44 1
CP001510_0600 CDS_678495-677029 129.4 7.8e-44 1
CP001510_3277 CDS_3657699-3655948 124.2 4.7e-42 1
CP001510_1474 CDS_1666513-1667523 113.7 1.7e-38 1
CP001510_3936 CDS_4367513-4364730 111.9 7.2e-38 1
CP001510_1835 CDS_2070306-2072447 110.3 2.5e-37 1
CP001510_1916 CDS_2178510-2180432 96.7 1.1e-32 1
CP001510_0642 CDS_714702-717968 84.5 1.6e-28 2
CP001510_4622 CDS_5126215-5129424 65.1 6.4e-22 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001510_1476 1/1 297 379 .. 1 85 [] 141.2 7.4e-48
CP001510_0890 1/1 799 881 .. 1 85 [] 131.7 1.3e-44
CP001510_0600 1/1 297 379 .. 1 85 [] 129.4 7.8e-44
CP001510_3277 1/1 385 472 .. 1 85 [] 124.2 4.7e-42
CP001510_1474 1/1 147 227 .. 1 85 [] 113.7 1.7e-38
CP001510_3936 1/1 727 809 .. 1 85 [] 111.9 7.2e-38
CP001510_1835 1/1 500 586 .. 1 85 [] 110.3 2.5e-37
CP001510_1916 1/1 439 522 .. 1 85 [] 96.7 1.1e-32
CP001510_0642 2/2 881 964 .. 1 85 [] 82.5 7.2e-28
CP001510_4622 1/1 726 807 .. 1 85 [] 65.1 6.4e-22

Alignments of top-scoring domains:
CP001510_1476: domain 1 of 1, from 297 to 379: score 141.2, E = 7.4e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HRVKN++A+ QSia+QTlRna+ lde++e++++RL++L++aHd
CP001510_1 297 ELTHRVKNSMATMQSIAHQTLRNAGGLDEARETLDARLASLAAAHDA 343

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L r++W+gA+L+e++e++L+P+++ +a+R+t++GP+
CP001510_1 344 --LIRENWGGATLGEIVERALQPFRSGAARRFTVTGPE 379

CP001510_0890: domain 1 of 1, from 799 to 881: score 131.7, E = 1.3e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtL++VQ+ia QTlRna++ld+++eaF++RL +L+raHd+
CP001510_0 799 ELQHRVKNTLTLVQAIASQTLRNAPDLDAAREAFAARLISLGRAHDI 845

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltrs+W A ++e++e +La ++g++ Ri+ sGP+
CP001510_0 846 --LTRSSWTEAPIAEVVEGALAVHRGAAMARIRASGPS 881

CP001510_0600: domain 1 of 1, from 297 to 379: score 129.4, E = 7.8e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HRVKNt+A+VQSia+QTlRnaasld++++++++RL +L++aHd+
CP001510_0 297 EMKHRVKNTIATVQSIAHQTLRNAASLDDARRTLDARLNSLAAAHDI 343

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt + ag++L+e +e++L+P++ + Ri++ GP+
CP001510_0 344 --LTTEATAGVTLAEAVESALQPFRVSPRNRIRFGGPE 379

CP001510_3277: domain 1 of 1, from 385 to 472: score 124.2, E = 4.7e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ+i+ T+R+a+s+d+f+eaF gR+ +L+ +H++
CP001510_3 385 ELHHRVKNTLATVQAIVGSTARTATSIDSFHEAFVGRIKSLAHTHSV 431

VpLtrseWagAdLreLleaeLaPygged.....aeRitlsGPd<-*
Lt++ W+ A+Lr+Ll++eL Py+ ++++++ Ri+l+GP+
CP001510_3 432 --LTEATWQTASLRDLLASELMPYAESEtetspDLRIVLDGPA 472

CP001510_1474: domain 1 of 1, from 147 to 227: score 113.7, E = 1.7e-38
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ++ + T R++ s+ ef +a+sgR+++L+r+H L
CP001510_1 147 ELHHRVKNTLATVQAVLNATMRSSLSVSEFTRALSGRIASLARTHAL 193

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t++ ++ A++ Ll+aeL+Py+ ++R+tl+GP+
CP001510_1 194 --ITEDLAQAASFEGLLRAELDPYDE--RGRLTLEGPA 227

CP001510_3936: domain 1 of 1, from 727 to 809: score 111.9, E = 7.2e-38
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KNtL++ Q+ia QTlRna+++++ +ea+ +RL+AL+ aHd+
CP001510_3 727 ELSHRLKNTLTMAQAIASQTLRNATDIASVKEALVARLVALGKAHDI 773

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L e++gA L ++++ +L +++ ++Ri+lsGPd
CP001510_3 774 --LLSGEGEGAALEAVIAGALTIHDDGEPGRIHLSGPD 809

CP001510_1835: domain 1 of 1, from 500 to 586: score 110.3, E = 2.5e-37
*->ELnHRVKNtLAvVQSiarQTlRn..aasldefveaFsgRLqALsraH
ELnHRVKNtLA+VQSia Q+lR+ + ++ ++++aF++RL AL+raH
CP001510_1 500 ELNHRVKNTLATVQSIAMQSLRGldGEEALAARAAFEARLLALARAH 546

dLVpLtrseWagAdLreLleaeLaPygged..aeRitlsGPd<-*
d+ Ltr++W+gA+L+ ++ +++P ++ d+++ R+++sGP+
CP001510_1 547 DV--LTRESWEGAELKTVVGDAIRPLEAGDgqESRFVVSGPR 586

CP001510_1916: domain 1 of 1, from 439 to 522: score 96.7, E = 1.1e-32
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+L vV Sia+QT +++ + f+e+F +RL+ALsr+++L
CP001510_1 439 ELQHRTRNLLGVVRSIAHQTMAQTGPTERFREQFNDRLAALSRVQGL 485

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L+rse ++ +Lr L++ eL++ gg + a Ri++ GP+
CP001510_1 486 --LSRSEQEPITLRTLIRTELDALGGGdFANRIHIAGPP 522

CP001510_0642: domain 2 of 2, from 881 to 964: score 82.5, E = 7.2e-28
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+++vV S+a QT +++s++ f+++F +RL+ Lsr+++L
CP001510_0 881 ELQHRTRNLITVVRSLAEQTMARSDSMPMFRARFYDRLAVLSRVQGL 927

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L+rs ++ +L++L++ eL++ g+ ++++Ri l+GP+
CP001510_0 928 --LSRSTIEPITLHALIATELDALGAWeASHRIYLDGPS 964

CP001510_4622: domain 1 of 1, from 726 to 807: score 65.1, E = 6.4e-22
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+N++Av Si++ T +a+++ +++ + gRL L+r++ L
CP001510_4 726 ELQHRVRNIMAVTRSIVARTGERAETVSDYASLVGGRLLTLARVQAL 772

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltrs ag+ + +++ e+++ + a++ lsGP
CP001510_4 773 --LTRSPNAGVPVATIVRDEIDAQDLR-ADQYDLSGPK 807


Histogram of all scores:
score obs exp (one = represents 16 sequences)
----- --- ---
-17 1 0|=
-16 4 0|=
-15 3 0|=
-14 21 0|==
-13 79 0|=====
-12 365 0|=======================
-11 414 40|==*=======================
-10 660 513|================================*=========
-9 861 1272|====================================================== *
-8 889 1320|======================================================== *
-7 632 887|======================================== *
-6 409 484|========================== *
-5 262 239|==============*==
-4 148 113|=======*==
-3 83 52|===*==
-2 52 24|=*==
-1 29 11|*=
0 15 5|*
1 12 2|*
2 7 1|*
3 3 0|=
4 3 0|=
> 5 18 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 3942.2219
P(chi-square) = 0

Total sequences searched: 4970

Whole sequence top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: