hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001562.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001562_1421 CDS_1906184-1907197 130.1 1.6e-44 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001562_1421 1/1 141 223 .. 1 85 [] 130.1 1.6e-44
Alignments of top-scoring domains:
CP001562_1421: domain 1 of 1, from 141 to 223: score 130.1, E = 1.6e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN+LA++QSia QT+R ++sl+ f+++F gRL++Ls ++dL
CP001562_1 141 EVSHRSKNLLAIIQSIASQTARYTESLQVFLRKFQGRLHSLSHSQDL 187
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+s+W+gA +reL++ + y + eR+ l+G d
CP001562_1 188 --ITDSDWRGAQFRELVQTQALGYFMKETERFSLEGVD 223
Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 9 0|==
-13 52 0|=========
-12 251 0|==========================================
-11 241 14|==*======================================
-10 351 179|=============================*=============================
-9 226 444|====================================== *
-8 251 461|========================================== *
-7 147 310|========================= *
-6 78 169|============= *
-5 63 83|=========== *
-4 26 39|===== *
-3 18 18|==*
-2 9 8|=*
-1 3 3|*
0 6 1|*
1 1 0|=
> 2 5 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4135.7085
P(chi-square) = 0
Total sequences searched: 1737
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K