hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001579.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001579_0570 CDS_575007-576476 139.2 8.2e-48 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001579_0570 1/1 285 367 .. 1 85 [] 139.2 8.2e-48
Alignments of top-scoring domains:
CP001579_0570: domain 1 of 1, from 285 to 367: score 139.2, E = 8.2e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E HR+KN++A+VQSia+QTlRn+ +++++++ Fs RL+ALs+aHd+
CP001579_0 285 EIAHRFKNSMAMVQSIANQTLRNTYDPEQANRLFSERLRALSQAHDM 331
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++W gA++ ++++ +LaP+++ a Ri++sGP+
CP001579_0 332 --LLKENWVGATIQQICATALAPFNSTFANRIHMSGPH 367
Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-15 1 0|=
-14 8 0|==
-13 31 0|========
-12 116 0|=============================
-11 103 9|==*=======================
-10 204 120|=============================*=====================
-9 200 298|================================================== *
-8 198 310|================================================== *
-7 117 208|============================== *
-6 77 113|==================== *
-5 54 56|=============*
-4 27 26|======*
-3 15 12|==*=
-2 8 5|=*
-1 4 2|*
0 2 1|*
> 1 2 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 1100.0197
P(chi-square) = 0
Total sequences searched: 1167
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K