Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Beutenbergia cavernae DSM 12333  

Data for CP001618  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001618.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001618_2800 CDS_3147934-3149205 92.0 8.1e-27 1
CP001618_1045 CDS_1191366-1190101 89.6 4.2e-26 1
CP001618_0102 CDS_112018-110837 86.8 2.8e-25 1
CP001618_0234 CDS_256357-257664 84.5 1.3e-24 2
CP001618_3866 CDS_4310806-4312092 81.4 1.1e-23 1
CP001618_0294 CDS_317397-318566 80.5 2e-23 1
CP001618_0403 CDS_458119-456980 78.6 7.3e-23 1
CP001618_0286 CDS_310027-308915 78.5 8e-23 1
CP001618_2688 CDS_3010503-3011696 74.5 1.2e-21 1
CP001618_1811 CDS_2084293-2083139 71.1 1.2e-20 1
CP001618_3779 CDS_4221442-4222566 70.7 1.6e-20 1
CP001618_3005 CDS_3376804-3378153 69.8 2.8e-20 1
CP001618_1577 CDS_1828592-1829911 69.8 2.8e-20 1
CP001618_3518 CDS_3937097-3935802 68.3 8e-20 1
CP001618_3978 CDS_4428302-4427052 67.2 1.7e-19 1
CP001618_0713 CDS_793788-792487 63.5 2e-18 1
CP001618_2669 CDS_2987179-2985842 62.7 3.6e-18 1
CP001618_0586 CDS_652241-651081 61.4 8.4e-18 1
CP001618_2467 CDS_2776850-2775645 61.2 9.8e-18 1
CP001618_2434 CDS_2740886-2739588 60.5 1.6e-17 1
CP001618_1722 CDS_1981944-1980781 57.2 1.5e-16 1
CP001618_4130 CDS_4586704-4588695 50.3 1.6e-14 1
CP001618_0335 CDS_361626-360400 49.9 2.1e-14 1
CP001618_1603 CDS_1855946-1854294 47.1 1.4e-13 1
CP001618_2175 CDS_2464293-2462467 45.2 5.1e-13 1
CP001618_1353 CDS_1554967-1553537 39.4 2.6e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001618_2800 1/1 186 253 .. 1 70 [] 92.0 8.1e-27
CP001618_1045 1/1 217 284 .. 1 70 [] 89.6 4.2e-26
CP001618_0102 1/1 181 248 .. 1 70 [] 86.8 2.8e-25
CP001618_0234 2/2 227 294 .. 1 70 [] 84.5 1.4e-24
CP001618_3866 1/1 218 285 .. 1 70 [] 81.4 1.1e-23
CP001618_0294 1/1 165 234 .. 1 70 [] 80.5 2e-23
CP001618_0403 1/1 179 246 .. 1 70 [] 78.6 7.3e-23
CP001618_0286 1/1 180 247 .. 1 70 [] 78.5 8e-23
CP001618_2688 1/1 197 264 .. 1 70 [] 74.5 1.2e-21
CP001618_1811 1/1 186 253 .. 1 70 [] 71.1 1.2e-20
CP001618_3779 1/1 191 255 .. 1 70 [] 70.7 1.6e-20
CP001618_3005 1/1 238 305 .. 1 70 [] 69.8 2.8e-20
CP001618_1577 1/1 237 304 .. 1 70 [] 69.8 2.8e-20
CP001618_3518 1/1 215 281 .. 1 70 [] 68.3 8e-20
CP001618_3978 1/1 206 274 .. 1 70 [] 67.2 1.7e-19
CP001618_0713 1/1 204 270 .. 1 70 [] 63.5 2e-18
CP001618_2669 1/1 214 290 .. 1 70 [] 62.7 3.6e-18
CP001618_0586 1/1 189 250 .. 1 64 [. 61.4 8.4e-18
CP001618_2467 1/1 196 264 .. 1 70 [] 61.2 9.8e-18
CP001618_2434 1/1 227 288 .. 1 64 [. 60.5 1.6e-17
CP001618_1722 1/1 175 242 .. 1 70 [] 57.2 1.5e-16
CP001618_4130 1/1 454 521 .. 1 70 [] 50.3 1.6e-14
CP001618_0335 1/1 199 265 .. 1 70 [] 49.9 2.1e-14
CP001618_1603 1/1 341 405 .. 1 70 [] 47.1 1.4e-13
CP001618_2175 1/1 401 468 .. 1 70 [] 45.2 5.1e-13
CP001618_1353 1/1 279 346 .. 3 70 .] 39.4 2.6e-11

Alignments of top-scoring domains:
CP001618_2800: domain 1 of 1, from 186 to 253: score 92.0, E = 8.1e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+v++sLs+++ q+++ r+++ + dp++a +al++i
CP001618_2 186 ERARIAREMHDVVAHSLSVVIAQADGGRYAA--ANDPAAATRALTTI 230

relarealaevRrllgdLRpaal<-*
e++r ala++Rr+lg+LR +
CP001618_2 231 SETGRAALADMRRILGVLRSGPG 253

CP001618_1045: domain 1 of 1, from 217 to 284: score 89.6, E = 4.2e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+v++sLs+++ +++a+++l +k p++ar+a+d +
CP001618_1 217 ERARIAREMHDVVAHSLSVMITLADGAQAIL--EKSPDRARTAMDDV 261

relarealaevRrllgdLRpaal<-*
+e++r al ++Rr+lg+LR+++
CP001618_1 262 AETGRSALGDMRRVLGALRDDEA 284

CP001618_0102: domain 1 of 1, from 181 to 248: score 86.8, E = 2.8e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARELHD++++sLsai++q+++a++ll d+dp+ ar+al i
CP001618_0 181 ERLRLARELHDVLAHSLSAIAVQAGVAAHLL--DRDPDLARRALLDI 225

relarealaevRrllgdLRpaal<-*
r+ + e+l+evR l+g LR +++
CP001618_0 226 RTQSTESLDEVRSLIGILRADGD 248

CP001618_0234: domain 2 of 2, from 227 to 294: score 84.5, E = 1.4e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHDsvg++L++ +lq+ +a+rll +dp+++real++i
CP001618_0 227 ERNRLARELHDSVGHALTVTTLQATAAERLL--SRDPDAVREALRAI 271

relarealaevRrllgdLRpaal<-*
++++r ala++ ++lg LR ++
CP001618_0 272 QDTGRSALADLDHALGLLRSDDA 294

CP001618_3866: domain 1 of 1, from 218 to 285: score 81.4, E = 1.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+ +++Ls+i +q+ +a rll d++pe++re l+ i
CP001618_3 218 ERGRIARELHDVAAHHLSGIVVQATAADRLL--DREPERVRESLASI 262

relarealaevRrllgdLRpaal<-*
r+ +re+l+ +R ++g LR a+
CP001618_3 263 RAQGRETLENLRGVVGLLRGADT 285

CP001618_0294: domain 1 of 1, from 165 to 234: score 80.5, E = 2e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+++++L++i+ +++++++ d++pe+a++a++++
CP001618_0 165 ERTRIAREMHDTLAHRLTLIAATAGALEYRP--DAPPEQAAAAAARV 209

relarealaevRrllgdLR..paal<-*
r++++ al+++R +l+ LR +p++l
CP001618_0 210 RDAVSGALDDLRGILRLLRagPDEL 234

CP001618_0403: domain 1 of 1, from 179 to 246: score 78.6, E = 7.3e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD+v+++ sai++q+++ ++ + pe+a+e l++i
CP001618_0 179 ERVALARELHDTVAHHVSAIAVQAQAGGVVA--GAQPEKAAEVLAAI 223

relarealaevRrllgdLRpaal<-*
+ a+++lae+R ++++LR+ +
CP001618_0 224 ESEASQTLAEMRSMVRVLREEEA 246

CP001618_0286: domain 1 of 1, from 180 to 247: score 78.5, E = 8e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+AR+ HD vg+sL+++++++elarrl+ +dp++a +l+ i
CP001618_0 180 ERARLARDVHDLVGHSLTVVAVKAELARRLV--SRDPDAATGELADI 224

relarealaevRrllgdLRpaal<-*
+elar ala+vR ++++ R +l
CP001618_0 225 HELARSALADVRSMVQATRGVTL 247

CP001618_2688: domain 1 of 1, from 197 to 264: score 74.5, E = 1.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v+++L+ai + +++a r++ + p++ ea++ i
CP001618_2 197 ERTRIARELHDVVAHHLTAIVVRAQAADRVA--AHQPAAPSEAVRWI 241

relarealaevRrllgdLRpaal<-*
++ + +al+ +R ++++LR++a
CP001618_2 242 AQEGGTALTAMRSVVRVLRDDAP 264

CP001618_1811: domain 1 of 1, from 186 to 253: score 71.1, E = 1.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARE HD+v++sL+++ q+++a+ ++ ++dp++ r+ + ++
CP001618_1 186 ERELMAREVHDVVAHSLTVVVAQADAALLVM--EADPQRSRTMVSNA 230

relarealaevRrllgdLRpaal<-*
+++rea+ae+ r++++LR++a
CP001618_1 231 VTTGREAMAEMQRVVRVLRDGAP 253

CP001618_3779: domain 1 of 1, from 191 to 255: score 70.7, E = 1.6e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD vg++L++++l le a ++ +++a+e++ ++
CP001618_3 191 ERLRIARELHDAVGHQLTVLALELEIAS-----HRSAPPAAEHVVRA 232

relarealaevRrllgdLRpaal<-*
r++ar+ la+vR+++g+LR+ a
CP001618_3 233 RGIARDLLADVRQVVGELRERAP 255

CP001618_3005: domain 1 of 1, from 238 to 305: score 69.8, E = 2.8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARELHD v+++ s++ +q+ +ar+l+ ++dp++ + al+ +
CP001618_3 238 ERLRLARELHDAVAHHVSLMGVQAAAARTLA--ATDPARSAVALEHV 282

relarealaevRrllgdLRpaal<-*
++ area +e+ llg+LR++a
CP001618_3 283 EDSAREAVSELHGLLGTLREDAP 305

CP001618_1577: domain 1 of 1, from 237 to 304: score 69.8, E = 2.8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI+R++HD+vg +Ls +++++ela+ l+ ++d++ a +++ +
CP001618_1 237 ERLRISRDMHDVVGRALSTVAVKSELAAELA--RRDDAGAVREMLDV 281

relarealaevRrllgdLRpaal<-*
r+la+++l+evR ++ ++R a+l
CP001618_1 282 RTLAQDSLREVRGVVAGYRAADL 304

CP001618_3518: domain 1 of 1, from 215 to 281: score 68.3, E = 8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q+L++i ql++a+ ++ + +pe+ ++++++
CP001618_3 215 ERQRMAREIHDTLAQGLAGILTQLQAAE-QA--AHEPEAWGRHVTNA 258

relarealaevRrllgdLRpaal<-*
+lare+lae+Rr++++ p al
CP001618_3 259 TDLARESLAEARRTVHAVEPEAL 281

CP001618_3978: domain 1 of 1, from 206 to 274: score 67.2, E = 1.7e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHDsvg++ a++l++++a+ +l + +p++a++ l+ +
CP001618_3 206 ERLRIARDLHDSVGHTVVAVSLHADVAAEALA-AGEPDAAARSLALA 251

relarealaevRrllgdLRpaal<-*
r +a ++++e+R+ +g LR+++
CP001618_3 252 RSAAADSMRELRASVGLLRDGGA 274

CP001618_0713: domain 1 of 1, from 204 to 270: score 63.5, E = 2e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+A E+HD+++Q+L++++ qle+a++ l d+ + ++++ +
CP001618_0 204 ERARLAGEIHDTLAQGLAGVTAQLEAAEAEL---GDAHPSVRRVRLA 247

relarealaevRrllgdLRpaal<-*
r+lare+l+e+Rr + +LRp+ l
CP001618_0 248 RDLARESLREARRSVAALRPGPL 270

CP001618_2669: domain 1 of 1, from 214 to 290: score 62.7, E = 3.6e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrllds...dkdpe....ea
ER+RIARE+HD+++++Ls+++++++++++++ + + +p+ ++ +
CP001618_2 214 ERERIAREMHDVLAHRLSLLAVHAGALEYRVNQvaaAGAPPltpaDL 260

realdeirelarealaevRrllgdLRpaal<-*
++ + +r a+ al+e+R +l++LR +++
CP001618_2 261 ERSVGVVRSNAHLALEELRGVLQVLRGSGE 290

CP001618_0586: domain 1 of 1, from 189 to 250: score 61.4, E = 8.4e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R +RELHD++g++L +i+l++ela+ l+ ++dp++ar + +ei
CP001618_0 189 ERLRVSRELHDVLGHRLGVIALKAELAADLA--ARDPARARSENEEI 233

relarealaevRrllgd<-*
r++a ++lae+R+++++
CP001618_0 234 RAIAVDTLAEARAAVQG 250

CP001618_2467: domain 1 of 1, from 196 to 264: score 61.2, E = 9.8e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q++s+i l l +a ++l+ + d + ar+++++
CP001618_2 196 ERERLAREIHDTLAQGFSSIELLLRAADAALE-RGDVAGARRHVTTS 241

relarealaevRrllgdLRpaal<-*
re+a+ lae Rr + dL p++l
CP001618_2 242 REAAHANLAESRRFVADLAPPDL 264

CP001618_2434: domain 1 of 1, from 227 to 288: score 60.5, E = 1.6e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ RE+HD+v+++L++i +q+++ ++++ d+ p+ +al++i
CP001618_2 227 ERARLTREMHDVVAHGLAVIVMQAQGGAAAF--DRRPADTLAALEAI 271

relarealaevRrllgd<-*
+++r +la++R++lg+
CP001618_2 272 VATGRASLADMRQALGT 288

CP001618_1722: domain 1 of 1, from 175 to 242: score 57.2, E = 1.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+A E HD vg++L+ai +q++ a++l ++ p++a al++i
CP001618_1 175 ERLRLATEVHDIVGHGLAAIQMQADIALHLG--ARKPDQATIALEAI 219

relarealaevRrllgdLRpaal<-*
++ al e+R +lg p+ +
CP001618_1 220 SSASAAALGELRTTLGSVAPGSD 242

CP001618_4130: domain 1 of 1, from 454 to 521: score 50.3, E = 1.6e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ I RELHD++g Ls+++l+l++ar +l ++dp++a+ l+++
CP001618_4 454 ERKLIRRELHDGIGPWLSGLRLGLQGARNVL--RSDPDAADSVLAAL 498

relarealaevRrllgdLRpaal<-*
+e + + ++vR l + L p++l
CP001618_4 499 QEEVGQRVEDVRLLSRSLLPPVL 521

CP001618_0335: domain 1 of 1, from 199 to 265: score 49.9, E = 2.1e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+R+AR+LHD v+ sa+ +++e+a+ +++p++++ r+al+
CP001618_0 199 ERTRMARDLHDAVAGEVSAVVIHAEAAL-----AAPPDheRDRAALT 240

eirelarealaevRrllgdLRpaal<-*
++r+ + alae+R l+ LR +
CP001618_0 241 AVRAGGLAALAEMRTLIEILRARES 265

CP001618_1603: domain 1 of 1, from 341 to 405: score 47.1, E = 1.4e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR+LHD Q+L+a + le+a+ ++++++ r+ ++e
CP001618_1 341 ERARIARDLHDLAIQQLFATGMRLERAA-----TTAAAAERALIEES 382

relarealaevRrllgdLRpaal<-*
+ ++e+ +++R +++ LR+ ++
CP001618_1 383 IADVDESVRQIRGIVRSLRDRDE 405

CP001618_2175: domain 1 of 1, from 401 to 468: score 45.2, E = 5.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD + +L+++ l + ++ ll + ++++++ ++++
CP001618_2 401 ERRRLRRDLHDDLVPTLAGLGLDAAAITELL--RGRDDAIARVAATL 445

relarealaevRrllgdLRpaal<-*
++ +r++ +++R+++ dLRp++l
CP001618_2 446 AQGIRDSTRQIREIAYDLRPPVL 468

CP001618_1353: domain 1 of 1, from 279 to 346: score 39.4, E = 2.6e-11
*->aRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealdeir
+RI R+LHD+ +L a+++ql+ a+ +l+ ++ ++e+ + + +++
CP001618_1 279 RRIERDLHDGTQARLVAVAMQLGEAKEQLT-TTQTDpELVDLVSNAH 324

elarealaevRrllgdLRpaal<-*
+ +ea+ae+R+l+++++p+al
CP001618_1 325 ASTKEAIAELRELARGIHPPAL 346


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-13 17 0|==
-12 39 46|====*
-11 73 384|======= *
-10 343 892|================================ *
-9 633 1013|==========================================================*
-8 563 781|==================================================== *
-7 640 491|============================================*==============
-6 556 277|=========================*=========================
-5 536 149|=============*===================================
-4 289 77|======*====================
-3 172 40|===*============
-2 110 20|=*========
-1 84 10|*=======
0 50 5|*====
1 26 2|*==
2 14 1|*=
3 9 0|=
4 8 0|=
5 2 0|=
6 3 0|=
7 1 0|=
8 1 0|=
9 0 0|
> 10 28 -|===


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 4421.5605
P(chi-square) = 0

Total sequences searched: 4197

Whole sequence top hits:
tophits_s report:
Total hits: 26
Satisfying E cutoff: 26
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 26
Satisfying E cutoff: 26
Total memory: 30K


Acknowledgements:

This research is funded by:

Developed by: