Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
41 projects found  

1 accessions found for Dyadobacter fermentans DSM 18053  

Data for CP001619  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001619.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001619_5377 CDS_6585373-6587622 105.2 1.3e-29 1
CP001619_5379 CDS_6589626-6591824 104.5 2.1e-29 1
CP001619_1598 CDS_1975314-1977116 95.6 7.1e-27 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001619_5377 1/1 541 627 .. 1 94 [] 105.2 1.3e-29
CP001619_5379 1/1 546 626 .. 1 94 [] 104.5 2.1e-29
CP001619_1598 1/1 381 465 .. 1 94 [] 95.6 7.1e-27

Alignments of top-scoring domains:
CP001619_5377: domain 1 of 1, from 541 to 627: score 105.2, E = 1.3e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+I+SL++ Qa + ++ + l a ++s +R+ +
CP001619_5 541 EVHHRVKNNLQMIISLIDSQASYLSNDA------LHAVMDSKHRIEA 581

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liH++LY ++++++++++ Y+++L+ +L++s g ++ is+ D+
CP001619_5 582 MSLIHQKLYLTDNTSSINMRIYIKELVTYLKDSLGFNRN-ISFTTDV 627

CP001619_5379: domain 1 of 1, from 546 to 626: score 104.5, E = 2.1e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+I SL++ Qa + + + l+a +s +R+ +
CP001619_5 546 EVHHRVKNNLQMIVSLIDSQASYLNNGA------LDAVLDSKHRIEA 586

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liH++LY sed+ tv+++ Y+++L+ +L+++ g + +
CP001619_5 587 MSLIHQKLYLSEDVTTVNMRWYINELITHLKDCIGSNQN-------I 626

CP001619_1598: domain 1 of 1, from 381 to 465: score 95.6, E = 7.1e-27
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRVKNNLQvI+SLL+LQ+++ +d + + + E+ R+ S
CP001619_1 381 EQNHRVKNNLQVIASLLSLQSDQLDDTPA-----RRLIDETLLRIES 422

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA++H++LY +e l +vd+++++ ++++ +++ gv+ ++
CP001619_1 423 MAILHRRLYDGEQLAQVDLADFIPEIVRGVLETLGVKQVSLD----Y 465


Histogram of all scores:
score obs exp (one = represents 22 sequences)
----- --- ---
-15 2 0|=
-14 25 0|==
-13 48 35|=*=
-12 239 375|=========== *
-11 1271 1045|===============================================*==========
-10 1160 1353|===================================================== *
-9 1108 1143|===================================================*
-8 753 766|==================================*
-7 440 455|====================*
-6 360 253|===========*=====
-5 128 136|======*
-4 78 72|===*
-3 52 37|=*=
-2 20 19|*
-1 16 10|*
0 7 5|*
1 3 2|*
2 5 1|*
3 0 0|
> 4 4 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 186.1411
P(chi-square) = 9.449e-33

Total sequences searched: 5719

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: