Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Corynebacterium kroppenstedtii DSM 44385  

Data for CP001620  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001620.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001620_1629 CDS_2000563-2001801 52.9 1.3e-15 1
CP001620_0480 CDS_607064-606198 40.7 5.2e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001620_1629 1/1 188 252 .. 9 70 .] 52.9 1.3e-15
CP001620_0480 1/1 53 120 .. 1 70 [] 40.7 5.2e-12

Alignments of top-scoring domains:
CP001620_1629: domain 1 of 1, from 188 to 252: score 52.9, E = 1.3e-15
*->LHDsvgQsLsaiklqlelarrlldsdkdpe.....earealdeirel
+HD++++sL++i+++++la rll d+++++ +++ar ++d i el
CP001620_1 188 MHDVLSHSLTVIAVKAQLASRLL--DAEADkackdKARGEIDDIYEL 232

arealaevRrllgdLRpaal<-*
++ al+++R +l +L p+ l
CP001620_1 233 SHSALNDMRSALDELAPPSL 252

CP001620_0480: domain 1 of 1, from 53 to 120: score 40.7, E = 5.2e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI +LHD+ Q + a++l+l+ a+ + + +e+++ l+e
CP001620_0 53 ERRRIENDLHDGAQQYFVAASLKLGEAELEA--ENGSAELQRLLEET 97

relarealaevRrllgdLRpaal<-*
r +++++l +Rr++++++p++l
CP001620_0 98 RSHLDDGLHALRRTVHGIHPQVL 120


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 8 0|==
-13 31 0|=====
-12 63 22|===*=====
-11 89 184|============= *
-10 257 429|===================================== *
-9 377 487|====================================================== *
-8 310 375|============================================= *
-7 275 236|=================================*======
-6 178 133|==================*=======
-5 193 71|==========*=================
-4 88 37|=====*=======
-3 59 19|==*======
-2 36 9|=*====
-1 21 5|*==
0 10 2|*=
1 3 1|*
2 8 0|==
3 6 0|=
4 2 0|=
5 1 0|=
6 0 0|
> 7 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 725.5784
P(chi-square) = 0

Total sequences searched: 2018

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: