Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

6 accessions found for Rhizobium leguminosarum bv. trifolii WSM1325  

Data for CP001622  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001622.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001622_2384 CDS_2426433-2425369 98.5 8.9e-28 1
CP001622_0760 CDS_794308-793193 95.8 5.2e-27 1
CP001622_0089 CDS_86739-85663 82.7 2.7e-23 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001622_2384 1/1 159 243 .. 1 94 [] 98.5 8.9e-28
CP001622_0760 1/1 148 231 .. 1 94 [] 95.8 5.2e-27
CP001622_0089 1/1 162 250 .. 1 94 [] 82.7 2.7e-23

Alignments of top-scoring domains:
CP001622_2384: domain 1 of 1, from 159 to 243: score 98.5, E = 8.9e-28
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HR+ N+L ++ +L+r+Q+ ++d+ + ++aL+E+q R+ +
CP001622_2 159 EVNHRIANSLGLVGALIRMQSSMTTDQVA-----IDALHETQMRINA 200

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H++LY+++ +++v ++eYl+ L+ +L s+++++ ++ +
CP001622_2 201 IASVHRRLYTNRQVGSVQVDEYLNSLLTELETSMRDDKRPHR----I 243

CP001622_0760: domain 1 of 1, from 148 to 231: score 95.8, E = 5.2e-27
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+LQ+I+S L+ ar++++ee+ + +L+ +++RV+S
CP001622_0 148 EVQHRVANSLQIIASVLMQSARRVQSEEA-----RGHLHNAHHRVMS 189

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A ++++L++s + ++v+++ Y++ L+ +L s+ + d++s +
CP001622_0 190 IAALQRQLSMSNS-GKVELRTYFTQLCQSLGASMIADPDRLS----I 231

CP001622_0089: domain 1 of 1, from 162 to 250: score 82.7, E = 2.7e-23
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRVKNNLQ+I++L+r++ar+++ e e + +R+ +
CP001622_0 162 ELQHRVKNNLQMITALIRMEARNAQQNEE-----SERFARLAGRIEA 203

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
Al+++ L+ e tvd++ Y++ ++++ + +++v++++++ k+D+
CP001622_0 204 LALLYRSLSDEEKGATVDLGTYVSQIAASVMAAHAVEGIRLDMKVDT 250


Histogram of all scores:
score obs exp (one = represents 22 sequences)
----- --- ---
-15 10 0|=
-14 30 0|==
-13 76 28|=*==
-12 240 299|=========== *
-11 1273 834|=====================================*====================
-10 1014 1080|=============================================== *
-9 722 912|================================= *
-8 531 612|========================= *
-7 250 363|============ *
-6 227 202|=========*=
-5 91 109|====*
-4 45 57|==*
-3 26 30|=*
-2 15 15|*
-1 5 8|*
0 3 4|*
> 1 7 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 421.3270
P(chi-square) = 0

Total sequences searched: 4565

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: