Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

6 accessions found for Rhizobium leguminosarum bv. trifolii WSM1325  

Data for CP001622  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001622.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001622_3214 CDS_3278370-3279383 139.8 2e-47 1
CP001622_3224 CDS_3288845-3291412 125.9 1.1e-42 1
CP001622_2562 CDS_2603580-2605049 88.6 5.7e-30 1
CP001622_3597 CDS_3713317-3714969 70.8 6.7e-24 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001622_3214 1/1 140 222 .. 1 85 [] 139.8 2e-47
CP001622_3224 1/1 522 604 .. 1 85 [] 125.9 1.1e-42
CP001622_2562 1/1 298 379 .. 1 85 [] 88.6 5.7e-30
CP001622_3597 1/1 357 438 .. 1 85 [] 70.8 6.7e-24

Alignments of top-scoring domains:
CP001622_3214: domain 1 of 1, from 140 to 222: score 139.8, E = 2e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+LA++Q+ia+QT+Rn+ sld+f+ +F+gRLq+Ls+++dL
CP001622_3 140 ELSHRSKNLLAIIQGIATQTARNTLSLDSFLLKFRGRLQSLSNSQDL 186

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+s+W+gA L+eL+e ++aPy++e a+ + G +
CP001622_3 187 --ITDSSWRGAYLFELAEKQFAPYWPETAGSMPIYGIN 222

CP001622_3224: domain 1 of 1, from 522 to 604: score 125.9, E = 1.1e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRV+N+L+++ +i+rQ+ ++ l ++ ++++gR+q+L+raHd+
CP001622_3 522 ELNHRVRNILSLITGIIRQSQATSVGLGDYIRQLEGRIQSLARAHDQ 568

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+tr++Wa+A+Lr+Ll ae a+y g+ a+Ri++ G+d
CP001622_3 569 --ITRDHWAPASLRQLLLAETAAYLGKNAQRIQMGGED 604

CP001622_2562: domain 1 of 1, from 298 to 379: score 88.6, E = 5.7e-30
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN LA+VQ+ a T+R a++++ ++++F++RL++L+ra dL
CP001622_2 298 ELNHRVKNNLAMVQAFAFRTFRDAEDIPRALDSFTARLVSLGRANDL 344

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt + W++A+L++ l ++ P++++ ++R +l+G++
CP001622_2 345 --LTGELWSSASLKQTLDQATVPHRPD-GGRWELTGDE 379

CP001622_3597: domain 1 of 1, from 357 to 438: score 70.8, E = 6.7e-24
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR KN+L++ Q+++rQ +++++s++ f++a+++RL L r+ L
CP001622_3 357 ELVHRTKNLLTLAQAMMRQLAKQSDSVETFRAAVADRLEGLVRSIEL 403

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++W+g++Lr ++ + L ++ + +e+i +sG +
CP001622_3 404 --LTSEQWGGVSLRRVVDIHLHAFPQS-REQIDISGKN 438


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-15 1 0|=
-14 16 0|==
-13 67 0|=====
-12 386 0|==========================
-11 529 37|==*=================================
-10 678 472|===============================*==============
-9 832 1168|======================================================== *
-8 837 1212|======================================================== *
-7 533 814|==================================== *
-6 269 444|================== *
-5 186 220|============= *
-4 97 104|======*
-3 60 48|===*
-2 34 22|=*=
-1 20 10|*=
0 6 4|*
1 5 2|*
> 2 9 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 6974.7573
P(chi-square) = 0

Total sequences searched: 4565

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: