hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001624.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001624_0351 CDS_386749-385283 130.8 3.4e-45 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001624_0351 1/1 291 370 .. 1 85 [] 130.8 3.4e-45
Alignments of top-scoring domains:
CP001624_0351: domain 1 of 1, from 291 to 370: score 130.8, E = 3.4e-45
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA+V +iarQT+ +a++ +++++aF++RLq+L+raHdL
CP001624_0 291 ELNHRVKNILATVAAIARQTFAGAPDAEAARAAFDARLQSLARAHDL 337
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt +W+ A+L+ +++++L++y aeR+ +sGPd
CP001624_0 338 --LTHGNWEAASLGNVVSEALSAYP---AERLDISGPD 370
Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-14 3 0|==
-13 15 0|========
-12 44 0|======================
-11 65 5|==*==============================
-10 99 64|===============================*==================
-9 112 159|======================================================== *
-8 112 165|======================================================== *
-7 68 111|================================== *
-6 41 60|===================== *
-5 25 30|============= *
-4 20 14|======*===
-3 10 6|==*==
-2 2 3|=*
-1 5 1|*==
0 0 0|
1 0 0|
> 2 3 -|==
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 781.9641
P(chi-square) = 0
Total sequences searched: 624
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K