hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001625.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001625_0421 CDS_447171-448568 96.4 3.6e-28 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001625_0421 1/1 274 348 .. 1 80 [. 96.4 3.6e-28
Alignments of top-scoring domains:
CP001625_0421: domain 1 of 1, from 274 to 348: score 96.4, E = 3.6e-28
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L++++++L++Qar ++ ++v + +L +++ RV++
CP001625_0 274 EMSHRVKNSLMLVTAMLSMQARATDIPDV-----RRVLTDAETRVAT 315
mAliHEeLYksedldtvdfseYlekLtenLfqs<-*
+A +H++L++ dl+t+d++++l+ L++ L q+
CP001625_0 316 IAAVHDHLWRQPDLETIDLAAFLKDLCSRLAQT 348
Histogram of all scores:
score obs exp (one = represents 3 sequences)
----- --- ---
-14 4 0|==
-13 19 3|*======
-12 48 32|==========*=====
-11 146 90|=============================*===================
-10 92 116|=============================== *
-9 75 98|========================= *
-8 50 66|================= *
-7 20 39|======= *
-6 16 21|======*
-5 9 11|===*
-4 5 6|=*
-3 0 3|*
-2 3 1|*
-1 1 0|=
0 0 0|
1 1 0|=
> 2 5 -|==
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 68.7618
P(chi-square) = 8.665e-12
Total sequences searched: 494
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K
