Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

6 accessions found for Rhizobium leguminosarum bv. trifolii WSM1325  

Data for CP001625  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001625.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001625_0287 CDS_314462-313404 113.3 2.5e-39 1
CP001625_0138 CDS_145449-146474 103.6 4.7e-36 1
CP001625_0137 CDS_145253-144225 97.7 4.9e-34 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001625_0287 1/1 155 237 .. 1 85 [] 113.3 2.5e-39
CP001625_0138 1/1 144 226 .. 1 85 [] 103.6 4.7e-36
CP001625_0137 1/1 160 237 .. 1 85 [] 97.7 4.9e-34

Alignments of top-scoring domains:
CP001625_0287: domain 1 of 1, from 155 to 237: score 113.3, E = 2.5e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA V+Si+r+T+R+aas+d+++++F+ RLqALs++H
CP001625_0 155 ELNHRVKNILASVSSIFRMTRRGAASVDDLADDFTSRLQALSNVHTA 201

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++++ ++ ++L +++ +++Py++++ Ri +sGP+
CP001625_0 202 --VFEAGGEEVSLCDVVGLTVSPYNSDGMSRINVSGPE 237

CP001625_0138: domain 1 of 1, from 144 to 226: score 103.6, E = 4.7e-36
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KNtLAvVQ+i Q++Rna sl+++ ++++R+ A s aHd+
CP001625_0 144 ELSHRMKNTLAVVQAITSQSFRNASSLEDAEHSITARINAYSKAHDI 190

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W g +++ ++ea+ g e ++R+ sGP+
CP001625_0 191 --LLQQNWLGTSIATIVEATAINLGLETSGRFKASGPA 226

CP001625_0137: domain 1 of 1, from 160 to 237: score 97.7, E = 4.9e-34
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN LA+V Si+r + na++++ +++a+ R qAL+raH L
CP001625_0 160 EVDHRSKNVLAIVDSIVRLS--NADDPALYAAAIQHRVQALARAHTL 204

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++W + +L eL++++++P++ a+R +sGPd
CP001625_0 205 --LAARRWTSISLEELIRQQVSPFA---ATRTFFSGPD 237


Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-14 5 0|===
-13 15 0|========
-12 57 0|=============================
-11 57 4|=*===========================
-10 75 51|=========================*============
-9 93 126|=============================================== *
-8 85 131|=========================================== *
-7 34 88|================= *
-6 28 48|============== *
-5 23 23|===========*
-4 7 11|==== *
-3 2 5|= *
-2 4 2|*=
-1 2 1|*
> 0 7 -|====


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 79.7150
P(chi-square) = 4.092e-15

Total sequences searched: 494

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: