hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001627.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001627_0110 CDS_109076-110461 73.2 1.9e-22 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001627_0110 1/1 250 317 .. 1 70 [] 73.2 1.9e-22
Alignments of top-scoring domains:
CP001627_0110: domain 1 of 1, from 250 to 317: score 73.2, E = 1.9e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD+++Q+L +++ ++la r + +++ + a+ ++d+
CP001627_0 250 ERARLARELHDGISQNLVGVRYAMDLAGRKV--RTNVDDAALTIDRG 294
relarealaevRrllgdLRpaal<-*
e+++ a++e+Rrl +dLRp +l
CP001627_0 295 VEALNGAIKEIRRLSHDLRPRVL 317
Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-14 1 0|=
-13 2 0|==
-12 7 3|==*====
-11 9 25|========= *
-10 34 58|================================== *
-9 53 66|===================================================== *
-8 40 51|======================================== *
-7 43 32|===============================*===========
-6 19 18|=================*=
-5 32 9|========*=======================
-4 14 5|====*=========
-3 9 2|=*=======
-2 6 1|*=====
-1 2 0|==
0 2 0|==
> 1 2 -|==
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 95.6428
P(chi-square) = 8.545e-18
Total sequences searched: 275
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K