Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Micrococcus luteus NCTC 2665  

Data for CP001628  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001628.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001628_2082 CDS_2347649-2349070 79.2 2.5e-23 1
CP001628_1537 CDS_1772016-1773242 69.3 2.2e-20 1
CP001628_1762 CDS_2006559-2005183 66.4 1.5e-19 1
CP001628_0280 CDS_324412-325671 66.1 1.9e-19 1
CP001628_2079 CDS_2343276-2344469 59.7 1.4e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001628_2082 1/1 209 276 .. 1 70 [] 79.2 2.5e-23
CP001628_1537 1/1 204 271 .. 1 70 [] 69.3 2.2e-20
CP001628_1762 1/1 224 292 .. 1 70 [] 66.4 1.5e-19
CP001628_0280 1/1 207 272 .. 1 70 [] 66.1 1.9e-19
CP001628_2079 1/1 188 254 .. 1 70 [] 59.7 1.4e-17

Alignments of top-scoring domains:
CP001628_2082: domain 1 of 1, from 209 to 276: score 79.2, E = 2.5e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER++IARE+HD v++sL +i+ q+++ar+++ ++ pe a ++ld+i
CP001628_2 209 ERNHIAREMHDIVAHSLQVIISQADGARYAA--AAKPELAVATLDTI 253

relarealaevRrllgdLRpaal<-*
++r ala++R+llg+LR++++
CP001628_2 254 GLTGRAALADMRQLLGVLRETGE 276

CP001628_1537: domain 1 of 1, from 204 to 271: score 69.3, E = 2.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+R+ R+LHD +g+sL+ i+++++l++rl+ d+dp++a+++++e+
CP001628_1 204 QRERLGRDLHDILGHSLTTINVKTQLVHRLI--DADPARAKQEAAEV 248

relarealaevRrllgdLRpaal<-*
+l+r+alae+R+++ +L ++l
CP001628_1 249 IALSRTALAEARAAVAELAAPEL 271

CP001628_1762: domain 1 of 1, from 224 to 292: score 66.4, E = 1.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD++ Q+L++i l + +a+ +ld ++dp+ ar++++++
CP001628_1 224 ERERLAREIHDTLTQGLASIVLVSRAAQDALD-AADPALARQRMETV 269

relarealaevRrllgdLRpaal<-*
r++a e lae Rr ++dLR ++
CP001628_1 270 RATAAENLAESRRFVRDLRGTGA 292

CP001628_0280: domain 1 of 1, from 207 to 272: score 66.1, E = 1.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +AR+LHD+v+++L+ i++q+ +ar+l pe+a+ ld +
CP001628_0 207 ERRSLARDLHDVVAHNLTIISMQARTARYLG----TPEAAQGVLDVV 249

relarealaevRrllgdLRpaal<-*
+ a++al+++Rr+l+ L++++
CP001628_0 250 GDSAKDALRDLRRMLSILQEDGI 272

CP001628_2079: domain 1 of 1, from 188 to 254: score 59.7, E = 1.4e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A ELHD+vg++L++i+lq++++ +++ p + e ++i
CP001628_2 188 ERHRLALELHDVVGHGLTVIALQAGMLPTVT----SPVQRTEVEQAI 230

relarealaevRrllgdLR.paal<-*
+++ar++l+++R +lg+LR+ a
CP001628_2 231 ADTARQSLTDLRTMLGVLRgSAPG 254


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 1 0|=
-13 11 0|==
-12 19 24|===*
-11 50 204|========= *
-10 169 475|============================= *
-9 353 539|==========================================================*
-8 315 416|===================================================== *
-7 299 261|===========================================*======
-6 284 148|========================*=======================
-5 301 79|=============*=====================================
-4 162 41|======*====================
-3 90 21|===*===========
-2 68 10|=*==========
-1 40 5|*======
0 27 2|*====
1 11 1|*=
2 11 0|==
3 6 0|=
4 4 0|=
5 2 0|=
6 1 0|=
7 1 0|=
8 0 0|
9 1 0|=
10 1 0|=
11 1 0|=
12 1 0|=
> 13 7 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2238.6555
P(chi-square) = 0

Total sequences searched: 2236

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: