Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Actinosynnema mirum DSM 43827  

Data for CP001630  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001630.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001630_2696 CDS_3147876-3149168 91.5 1.8e-26 1
CP001630_2199 CDS_2470537-2469464 91.5 1.9e-26 1
CP001630_6826 CDS_8148082-8149290 89.3 8.6e-26 2
CP001630_3939 CDS_4765356-4764199 85.6 1e-24 1
CP001630_4142 CDS_5020878-5019589 82.6 8.2e-24 1
CP001630_2192 CDS_2462324-2461212 82.3 9.5e-24 1
CP001630_4380 CDS_5352063-5353289 81.5 1.7e-23 1
CP001630_3247 CDS_3890905-3889724 80.1 4.3e-23 1
CP001630_1912 CDS_2150945-2149854 79.9 5.1e-23 1
CP001630_6066 CDS_7316080-7314917 79.0 9e-23 1
CP001630_3152 CDS_3750581-3751756 77.7 2.2e-22 2
CP001630_6233 CDS_7500923-7499742 77.0 3.5e-22 1
CP001630_5039 CDS_6187858-6189195 71.3 1.7e-20 1
CP001630_4306 CDS_5228947-5227838 69.4 6.3e-20 1
CP001630_5729 CDS_6938694-6937027 69.1 7.8e-20 1
CP001630_0934 CDS_1054746-1053496 68.3 1.3e-19 1
CP001630_3284 CDS_3930994-3932274 66.9 3.4e-19 1
CP001630_6832 CDS_8154741-8153575 66.2 5.3e-19 1
CP001630_2997 CDS_3530221-3529055 65.9 6.6e-19 1
CP001630_0096 CDS_106220-107338 65.4 9.1e-19 1
CP001630_1983 CDS_2227176-2228363 65.1 1.2e-18 1
CP001630_5932 CDS_7160018-7158441 63.0 4.6e-18 1
CP001630_2661 CDS_3099079-3097790 61.1 1.8e-17 1
CP001630_3890 CDS_4682227-4683372 60.9 1.9e-17 1
CP001630_2717 CDS_3178769-3177600 59.1 6.6e-17 1
CP001630_4544 CDS_5575877-5577136 59.0 7e-17 1
CP001630_1593 CDS_1780367-1781476 58.5 1e-16 1
CP001630_1881 CDS_2116138-2117838 58.5 1e-16 1
CP001630_4846 CDS_5956275-5955058 55.6 7.4e-16 1
CP001630_0505 CDS_551682-552701 55.6 7.5e-16 1
CP001630_2376 CDS_2669374-2668343 51.8 9.3e-15 1
CP001630_0524 CDS_574854-573565 48.9 6.6e-14 2
CP001630_2951 CDS_3472670-3471507 48.3 1e-13 1
CP001630_5219 CDS_6386659-6387315 46.4 3.6e-13 1
CP001630_3606 CDS_4348504-4347563 33.0 3.4e-09 1
CP001630_2915 CDS_3434570-3435088 31.8 7.3e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001630_2696 1/1 225 292 .. 1 70 [] 91.5 1.8e-26
CP001630_2199 1/1 161 228 .. 1 70 [] 91.5 1.9e-26
CP001630_6826 1/2 197 264 .. 1 70 [] 89.2 8.9e-26
CP001630_3939 1/1 174 241 .. 1 70 [] 85.6 1e-24
CP001630_4142 1/1 232 299 .. 1 70 [] 82.6 8.2e-24
CP001630_2192 1/1 175 242 .. 1 70 [] 82.3 9.5e-24
CP001630_4380 1/1 185 252 .. 1 70 [] 81.5 1.7e-23
CP001630_3247 1/1 187 254 .. 1 70 [] 80.1 4.3e-23
CP001630_1912 1/1 178 246 .. 1 70 [] 79.9 5.1e-23
CP001630_6066 1/1 192 260 .. 1 70 [] 79.0 9e-23
CP001630_3152 1/2 195 262 .. 1 70 [] 77.6 2.4e-22
CP001630_6233 1/1 194 261 .. 1 70 [] 77.0 3.5e-22
CP001630_5039 1/1 229 294 .. 1 70 [] 71.3 1.7e-20
CP001630_4306 1/1 169 236 .. 1 70 [] 69.4 6.3e-20
CP001630_5729 1/1 209 275 .. 1 70 [] 69.1 7.8e-20
CP001630_0934 1/1 226 293 .. 1 70 [] 68.3 1.3e-19
CP001630_3284 1/1 154 222 .. 1 70 [] 66.9 3.4e-19
CP001630_6832 1/1 192 255 .. 1 70 [] 66.2 5.3e-19
CP001630_2997 1/1 192 256 .. 1 70 [] 65.9 6.6e-19
CP001630_0096 1/1 176 243 .. 1 70 [] 65.4 9.1e-19
CP001630_1983 1/1 207 271 .. 1 70 [] 65.1 1.2e-18
CP001630_5932 1/1 327 392 .. 1 70 [] 63.0 4.6e-18
CP001630_2661 1/1 231 298 .. 1 70 [] 61.1 1.8e-17
CP001630_3890 1/1 186 248 .. 1 70 [] 60.9 1.9e-17
CP001630_2717 1/1 200 267 .. 1 70 [] 59.1 6.6e-17
CP001630_4544 1/1 229 296 .. 1 70 [] 59.0 7e-17
CP001630_1593 1/1 160 225 .. 1 70 [] 58.5 1e-16
CP001630_1881 1/1 375 440 .. 1 70 [] 58.5 1e-16
CP001630_4846 1/1 189 254 .. 1 70 [] 55.6 7.4e-16
CP001630_0505 1/1 157 220 .. 1 70 [] 55.6 7.5e-16
CP001630_2376 1/1 154 219 .. 1 70 [] 51.8 9.3e-15
CP001630_2951 1/1 184 251 .. 6 70 .] 48.3 1e-13
CP001630_0524 2/2 244 306 .. 1 70 [] 47.4 1.8e-13
CP001630_5219 1/1 15 83 .. 1 70 [] 46.4 3.6e-13
CP001630_3606 1/1 119 185 .. 1 70 [] 33.0 3.4e-09
CP001630_2915 1/1 34 59 .. 1 26 [. 31.8 7.3e-09

Alignments of top-scoring domains:
CP001630_2696: domain 1 of 1, from 225 to 292: score 91.5, E = 1.8e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v+++ s++ +q+++arr+l +dpe a +al+++
CP001630_2 225 ERLRIARDLHDVVAHHVSVMGVQAGAARRVL--GTDPELAGAALRTV 269

relarealaevRrllgdLRpaal<-*
+e+ar+a++e+R llg+LR +++
CP001630_2 270 EETARTAITELRGLLGVLRADGE 292

CP001630_2199: domain 1 of 1, from 161 to 228: score 91.5, E = 1.9e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v++sLs+i++++++a ++ ++ pe ar+al +
CP001630_2 161 ERRRIARELHDVVAHSLSLIAVKTGTANHVC--ADLPEVARDALVVA 205

relarealaevRrllgdLRpaal<-*
++++r++l e+Rrllg+LR+ ++
CP001630_2 206 ERTSRDTLVEMRRLLGVLRDEDH 228

CP001630_6826: domain 1 of 2, from 197 to 264: score 89.2, E = 8.9e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++ s++ +q+++a +++ ++ pe a++a+++i
CP001630_6 197 ERSRIARELHDVVAHAVSVMVVQADGAGYAI--RTQPELAEAAVRTI 241

relarealaevRrllgdLRpaal<-*
+++r+alae+Rrllg+LR +
CP001630_6 242 SDTGRQALAELRRLLGVLRSEDG 264

CP001630_3939: domain 1 of 1, from 174 to 241: score 85.6, E = 1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARELHD+v++sL+++ +q+++ar++l d d e+areal+ i
CP001630_3 174 ERGEIARELHDVVAHSLAVMVMQADGARYAL--DGDREKAREALRVI 218

relarealaevRrllgdLRpaal<-*
+++r+al+++ r++ +LR a
CP001630_3 219 GDTGRDALQDMHRIVDVLRGVAG 241

CP001630_4142: domain 1 of 1, from 232 to 299: score 82.6, E = 8.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD+ +++Ls++ +q+++++rl+ d+dp++a+e + +
CP001630_4 232 ERARMARELHDVAAHHLSGMVVQASAVERLI--DRDPAAAKEGVVWL 276

relarealaevRrllgdLRpaal<-*
r+ +re+l+ +R+++g+LR +a+
CP001630_4 277 RGQGRETLDNLRAVVGVLRGGAD 299

CP001630_2192: domain 1 of 1, from 175 to 242: score 82.3, E = 9.5e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+AR+LHD+v+ +Lsai++q+e++++l d+dpe++r l+++
CP001630_2 175 ERARMARDLHDVVAGHLSAIAIQSEAVLTLP--DDDPERVRSVLRAV 219

relarealaevRrllgdLRpaal<-*
re + alae+R ++ +LR +++
CP001630_2 220 REGSVGALAEMRTMIDVLRADGE 242

CP001630_4380: domain 1 of 1, from 185 to 252: score 81.5, E = 1.7e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++++++i++++++a ++l ++ p+++ l i
CP001630_4 185 ERLRIARELHDVVAHHIAVISVHAGAAGHVL--RDRPDQVWPVLGHI 229

relarealaevRrllgdLRpaal<-*
r++a+ l+ev ++g+LR++++
CP001630_4 230 RGAADAVLDEVKSVIGVLRDPDE 252

CP001630_3247: domain 1 of 1, from 187 to 254: score 80.1, E = 4.3e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++++++s++++q++++ +++ d +e ++e ++ i
CP001630_3 187 ERNRIAREMHDVLAHRISLVAMQAGVLGHRA--DLRAEDVAELARGI 231

relarealaevRrllgdLRpaal<-*
+e +r+al+e+R++lg+LR + +
CP001630_3 232 AEGSRQALEELRDVLGVLRASPD 254

CP001630_1912: domain 1 of 1, from 178 to 246: score 79.9, E = 5.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD +g+sL+ ++++++larrll+ + + e+a ++ e+
CP001630_1 178 ERHRLGRDLHDILGHSLTTVTVKAGLARRLLE-RGEVERALGEVGEL 223

relarealaevRrllgdLRpaal<-*
++lar+al +vR+++g++R+ al
CP001630_1 224 ETLARQALGDVRATVGGYREVAL 246

CP001630_6066: domain 1 of 1, from 192 to 260: score 79.0, E = 9e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+v++++s++ + e+a ++l + pe+a +++e+
CP001630_6 192 ERARIAREMHDVVAHHMSMVVVRCETAPYRL--PGLPEAAVGEFAEL 236

relarealaevRrllgdLR.paal<-*
e ar a++++ rllg+LR ++++
CP001630_6 237 GEVARAAITDMQRLLGVLRaEGQH 260

CP001630_3152: domain 1 of 2, from 195 to 262: score 77.6, E = 2.4e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARELHD+v+++ +++ +q+++a+ + ++dp++ar+al +i
CP001630_3 195 ERLDIARELHDVVAHHVTGMLVQAQAALVVG--ERDPDAARRALPAI 239

relarealaevRrllgdLRpaal<-*
+ + +a +Rrl+g+LR ++
CP001630_3 240 VDGGTDAVGAMRRLVGALRGKED 262

CP001630_6233: domain 1 of 1, from 194 to 261: score 77.0, E = 3.5e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v++++++i++q+++a ++l d+dp++a++al i
CP001630_6 194 ERVRIARDLHDVVAHHIAVINVQAGAATHVL--DRDPAMAAQALGHI 238

relarealaevRrllgdLRpaal<-*
r++++ l e+ ++g+LR +++
CP001630_6 239 RDACEVVLGELSSIVGVLRQSGD 261

CP001630_5039: domain 1 of 1, from 229 to 294: score 71.3, E = 1.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HD+v+++ s+i++q++++r + +++ a++ + +i
CP001630_5 229 ERARLAREMHDVVSHQVSLIAVQAGALRVSV--RDP--DAKQVAGNI 271

relarealaevRrllgdLRpaal<-*
r l+ ++l+e+R+l+++LR a++
CP001630_5 272 RMLSTRTLNELRELVSVLRAADE 294

CP001630_4306: domain 1 of 1, from 169 to 236: score 69.4, E = 6.3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+R AR+LHD+vg+s+s++ l l +ar+ l ++ p+ea+eal+++
CP001630_4 169 DRQRVARDLHDVVGHSFSVVLLNLAGARMNL--AASPAEAEEALRRA 213

relarealaevRrllgdLRpaal<-*
++ +re++ae+R++l ++ ++
CP001630_4 214 ETVGREGMAELRQALVLMHRGDG 236

CP001630_5729: domain 1 of 1, from 209 to 275: score 69.1, E = 7.8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA+++HDs+g++Ls+i+++++++++ d + e+ rea+ +
CP001630_5 209 ERNRIAQDMHDSLGHRLSLISVHAGALAM--D-PGLGERQREAVGVL 252

relarealaevRrllgdLRpaal<-*
r++a +a++e+R ++g+LR +a+
CP001630_5 253 RGAALTAMEELRGVIGVLRRDAE 275

CP001630_0934: domain 1 of 1, from 226 to 293: score 68.3, E = 1.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L ++++ l++a+ l +dpe++r+ +de+
CP001630_0 226 ERRRIERDLHDGAQQRLVSVAMSLGRAKSKL--GSDPEAVRALIDEA 270

relarealaevRrllgdLRpaal<-*
++ a+ a++e+R+l++++ p++l
CP001630_0 271 HADAKLAISELRDLARGIYPSVL 293

CP001630_3284: domain 1 of 1, from 154 to 222: score 66.9, E = 3.4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD v+++L++i++q+++ar++l + + +++ald++
CP001630_3 154 ERTAIARELHDLVAHHLASITVQVGAARHAL--GGAHPGVDRALDQA 198

relarealaevRrllgdLR.paal<-*
++++r al+++ rl +LR+paa
CP001630_3 199 HGTGRAALTDLKRLMAVLRdPAAG 222

CP001630_6832: domain 1 of 1, from 192 to 255: score 66.2, E = 5.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD+v++ ++i +++++a+++ + +a+e l i
CP001630_6 192 ERMALARELHDVVAHYVTGIVVHAQAAQAVP--H----AAQEVLPII 232

relarealaevRrllgdLRpaal<-*
+ ++eal+ +Rrl+g+LR+++
CP001630_6 233 VTSGNEALTAMRRLVGTLRDSEA 255

CP001630_2997: domain 1 of 1, from 192 to 256: score 65.9, E = 6.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v+++ s+i+lq++++ +++++a++ i
CP001630_2 192 ERRRIAREMHDVVAHRVSVIALQSGALT-----VVGEGQVADAAEVI 233

relarealaevRrllgdLRpaal<-*
r+ + al+e+R++l++LR+++
CP001630_2 234 RRSSTAALSELRDVLRVLREDDA 256

CP001630_0096: domain 1 of 1, from 176 to 243: score 65.4, E = 9.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD+v Q+L+a +ql+l+ r l k ++ +++l+ +
CP001630_0 176 ERERIARDLHDVVIQRLFATGVQLDLLDRKL---KLEGREAKRLADA 219

relarealaevRrllgdLR.paal<-*
+ ++e++aevR+++++LR+++ +
CP001630_0 220 VDQLDETIAEVRATVRALRgTMPE 243

CP001630_1983: domain 1 of 1, from 207 to 271: score 65.1, E = 1.2e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v+++ s+i+lq++++ +++ ++ e +e ++ i
CP001630_1 207 ERRRIAREMHDVVAHRVSVIALQAGAL-TVI--ADG--ETAEVAEII 248

relarealaevRrllgdLRpaal<-*
r+ ++ alae+R++l++LR+++
CP001630_1 249 RKSGSAALAELRDVLRVLREDES 271

CP001630_5932: domain 1 of 1, from 327 to 392: score 63.0, E = 4.6e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+++ l+l+++ l+ + + ++e+l e
CP001630_5 327 DRDRIARDLHDLVVQRLFGLGLGLQGLNGLI--EQP--VVAERLGEF 369

relarealaevRrllgdLRpaal<-*
++++++e+Rr++ L+++
CP001630_5 370 VSEVDQTIREIRRTIFSLQEPSG 392

CP001630_2661: domain 1 of 1, from 231 to 298: score 61.1, E = 1.8e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L ai ++l++a r l ++d +++r+ l e+
CP001630_2 231 ELRRIERDLHDGAQARLVAIGMKLGAADRYL--ESDVDAVRTLLLEA 275

relarealaevRrllgdLRpaal<-*
re++ +al+e+R+l+++++p+ l
CP001630_2 276 REASVKALEELRNLVRGIHPPLL 298

CP001630_3890: domain 1 of 1, from 186 to 248: score 60.9, E = 1.9e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD v+++ s++ + +++ar l +e ++ei
CP001630_3 186 ERMQLARELHDLVAHHVSGVVVRAQAARVLG-------GSDEVFAEI 225

relarealaevRrllgdLRpaal<-*
++++++ala +Rr++g LR ++
CP001630_3 226 EAAGSDALAAMRRVVGMLRSPDY 248

CP001630_2717: domain 1 of 1, from 200 to 267: score 59.1, E = 6.6e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHDs +L a+ ++l+ a+r+l ++dp+ a + ++
CP001630_2 200 ELRRIERDLHDSTQNRLVAVVMHLGIAERAL--RRDPDSALPLVLRA 244

relarealaevRrllgdLRpaal<-*
r++a +al+ +R +++++ p++l
CP001630_2 245 RDAAGDALSGLRGVVRQIYPPVL 267

CP001630_4544: domain 1 of 1, from 229 to 296: score 59.0, E = 7e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R LHD+ +L a++l +++arr++ ++dp++a++ ld++
CP001630_4 229 ELRRIERSLHDGAQNHLVAVNLLVGAARRVV--HRDPAAADAVLDRA 273

relarealaevRrllgdLRpaal<-*
+e+a++al+e+R++++++ p++l
CP001630_4 274 QEAAEQALSELRAVVRAILPPVL 296

CP001630_1593: domain 1 of 1, from 160 to 225: score 58.5, E = 1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+vg++ +++++ + ++ + + +++ e r+a++++
CP001630_1 160 ERARIAREIHDVVGHHATLMAVEAAALSATT--PDP--ETRAAATRL 202

relarealaevRrllgdLRpaal<-*
r+la+ +l+e+R++lg L a
CP001630_1 203 RALAKASLTEMRATLGLLNAAPT 225

CP001630_1881: domain 1 of 1, from 375 to 440: score 58.5, E = 1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a + l++a+ ++ +++ ++re++d++
CP001630_1 375 DRDRIARDLHDHVIQRLFATGMSLQGALNRV--EDP--KLRERVDNA 417

relarealaevRrllgdLRpaal<-*
+ ++++ e+R ++ dL+ a++
CP001630_1 418 VHQLDQTVLEIRTTIFDLQAADD 440

CP001630_4846: domain 1 of 1, from 189 to 254: score 55.6, E = 7.4e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD+v ++L+++ l+++++ +++ +ar+a++ i
CP001630_4 189 ERRRLAEEMHDVVTHRLTLMVLHAGALGVGS--TDP--AARAAAEDI 231

relarealaevRrllgdLRpaal<-*
r ++ alae+R+llg+LR a+
CP001630_4 232 RVTGVSALAELRDLLGVLRGADG 254

CP001630_0505: domain 1 of 1, from 157 to 220: score 55.6, E = 7.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++ E+HD+++Q++++i +++a ++dp +a+++ld +
CP001630_0 157 ERERLSAEIHDTLAQGFTSIVTLVQAA------RADPVRADDHLDLA 197

relarealaevRrllgdLRpaal<-*
++are lae R+l+ +L paal
CP001630_0 198 LRTARENLAESRALVAALAPAAL 220

CP001630_2376: domain 1 of 1, from 154 to 219: score 51.8, E = 9.3e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R RE HD+v++sL ai+l +++a +l d++ ++r+ l e+
CP001630_2 154 ERLRVVREVHDVVSHSLGAIALTSGVAVHLG--DAE--ALRRGLVEV 196

relarealaevRrllgdLRpaal<-*
++++++a+ e+R +lg+ R+++
CP001630_2 197 ERTSKRAMGELRVALGGVRESGP 219

CP001630_2951: domain 1 of 1, from 184 to 251: score 48.3, E = 1e-13
*->ARELHDsvgQsLsaiklqlelarrlldsdkdpe....earealdeir
AR+LHD v+++ +ai q+ ++r+ + ++ ++ +++++++ l++i+
CP001630_2 184 ARDLHDFVAHHVTAIVAQARAVRYTT--ATGAQlspeALDTMLEAIE 228

elarealaevRrllgdLR.paal<-*
+++++al+ +R ++++LR++a
CP001630_2 229 KAGSQALTSMRGMITVLRdEAPA 251

CP001630_0524: domain 2 of 2, from 244 to 306: score 47.4, E = 1.8e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ +L +++l l+la++ l + e ++++
CP001630_0 244 ERRRIERDLHDGAQERLVGLTLRLGLAKAEL-------PENEDVAAA 283

relarealaevRrllgdLRpaal<-*
++ a++ + e+R+l+++++pa+l
CP001630_0 284 HDQAKRLMVELRELVRGIHPAVL 306

CP001630_5219: domain 1 of 1, from 15 to 83: score 46.4, E = 3.6e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+R RELHD+vg sL+ai+l+l +ar ll ++d+++a + l ++
CP001630_5 15 ARRRVLRELHDGVGPSLAAIALGLRAARELL--PRDAAAAGRLLVAL 59

relarealaevRrllgdLR.paal<-*
+e a+ a aevRrl+ d ++p++l
CP001630_5 60 EEEAHGAVAEVRRLAADAQhPPVL 83

CP001630_3606: domain 1 of 1, from 119 to 185: score 33.0, E = 3.4e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA + HD +g+ Ls+++l +++++ l+ ++ pe+ rea+ e+
CP001630_3 119 ERARIAHDAHDLLGHELSLLALRAGALE-LA--ADLPERHREAVGEL 162

relarealaevRrllgdLRpaal<-*
r+ a a + + l+ LR+++
CP001630_3 163 RGGAGAATERLAGLVALLRDGEP 185

CP001630_2915: domain 1 of 1, from 34 to 59: score 31.8, E = 7.3e-09
*->ERaRIARELHDsvgQsLsaiklqlel<-*
ER +ARELHD+++++ sai +++++
CP001630_2 34 ERGALARELHDTISHHVSAIGVHAGA 59


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-14 9 0|=
-13 54 1|*===
-12 104 77|====*==
-11 179 633|=========== *
-10 566 1470|================================== *
-9 934 1670|======================================================= *
-8 919 1287|======================================================= *
-7 970 809|===============================================*==========
-6 889 458|==========================*==========================
-5 904 245|==============*=======================================
-4 505 128|=======*======================
-3 304 65|===*==============
-2 200 33|=*==========
-1 138 17|*========
0 86 8|*=====
1 52 4|*===
2 17 2|*
3 22 1|*=
4 8 0|=
5 5 0|=
6 8 0|=
7 3 0|=
8 0 0|
9 0 0|
> 10 40 -|===


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 7846.4004
P(chi-square) = 0

Total sequences searched: 6916

Whole sequence top hits:
tophits_s report:
Total hits: 36
Satisfying E cutoff: 36
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 36
Satisfying E cutoff: 36
Total memory: 33K


Acknowledgements:

This research is funded by:

Developed by: