Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Brachybacterium faecium DSM 4810  

Data for CP001643  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001643.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001643_1964 CDS_2287040-2288365 91.9 6.4e-27 1
CP001643_0610 CDS_730996-732195 86.0 3.5e-25 1
CP001643_1117 CDS_1312524-1310686 81.7 6.7e-24 1
CP001643_2402 CDS_2798154-2799236 75.1 5.7e-22 1
CP001643_0231 CDS_276684-275398 70.1 1.7e-20 1
CP001643_0327 CDS_396561-395395 68.6 4.7e-20 1
CP001643_1221 CDS_1428320-1426986 64.6 7e-19 1
CP001643_1764 CDS_2055505-2056653 51.8 4.2e-15 1
CP001643_0026 CDS_27915-29159 51.3 5.9e-15 1
CP001643_0562 CDS_679934-678717 48.1 5.2e-14 1
CP001643_1147 CDS_1348395-1347052 41.8 3.8e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001643_1964 1/1 209 276 .. 1 70 [] 91.9 6.4e-27
CP001643_0610 1/1 204 271 .. 1 70 [] 86.0 3.5e-25
CP001643_1117 1/1 407 474 .. 1 70 [] 81.7 6.7e-24
CP001643_2402 1/1 157 224 .. 1 70 [] 75.1 5.7e-22
CP001643_0231 1/1 221 288 .. 1 70 [] 70.1 1.7e-20
CP001643_0327 1/1 203 270 .. 1 70 [] 68.6 4.7e-20
CP001643_1221 1/1 229 296 .. 1 70 [] 64.6 7e-19
CP001643_1764 1/1 173 246 .. 1 70 [] 51.8 4.2e-15
CP001643_0026 1/1 214 277 .. 1 70 [] 51.3 5.9e-15
CP001643_0562 1/1 195 260 .. 1 70 [] 48.1 5.2e-14
CP001643_1147 1/1 258 325 .. 1 70 [] 41.8 3.8e-12

Alignments of top-scoring domains:
CP001643_1964: domain 1 of 1, from 209 to 276: score 91.9, E = 6.4e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+v++sLs+i+ q+++ r ++ + pe+a+e l++i
CP001643_1 209 ERARIAREMHDVVAHSLSVIIAQADGGRFVA--AQKPEKAAEVLTTI 253

relarealaevRrllgdLRpaal<-*
e++r ala++R llg+LR ++
CP001643_1 254 GETGRAALADMRSLLGVLRQEDE 276

CP001643_0610: domain 1 of 1, from 204 to 271: score 86.0, E = 3.5e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD vg+sL+++++ ++larrll d+dpe+are+l+ i
CP001643_0 204 ERERIGRDLHDLVGHSLTSLTISAQLARRLL--DTDPEAAREQLTLI 248

relarealaevRrllgdLRpaal<-*
++++r+ala+vR++++++++
CP001643_0 249 ETTVRQALADVRATASGMQHVRA 271

CP001643_1117: domain 1 of 1, from 407 to 474: score 81.7, E = 6.7e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++s+s+i++q+++a ++l + ++e + +++ i
CP001643_1 407 ERGRIARELHDVVAHSMSVITVQAGTAPYRL--THLDAETASEFEDI 451

relarealaevRrllgdLRpaal<-*
++ ar+al e+R ll+ LR ++
CP001643_1 452 AASARQALGEMRSLLTILRSDDS 474

CP001643_2402: domain 1 of 1, from 157 to 224: score 75.1, E = 5.7e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD v++ +s++++++++++ + +++++ + i
CP001643_2 157 ERTRIAREMHDIVAHKISLVAMHAGALEVNP--NLERAQVQQSAGLI 201

relarealaevRrllgdLRpaal<-*
r++a +al+e+R++lg+LR +++
CP001643_2 202 RQTATTALSELREVLGVLRGDGE 224

CP001643_0231: domain 1 of 1, from 221 to 288: score 70.1, E = 1.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa +AR++HDsv+++L+ai++++++++++ d +pe +r+++ ++
CP001643_0 221 ERAALARDMHDSVSHHLAAIAMHAGAIAYRE--DLPPETLRRTAGTV 265

relarealaevRrllgdLRpaal<-*
r++a++a +e+R++l +LR++ +
CP001643_0 266 RDAAQQANRELREVLVALRTGSD 288

CP001643_0327: domain 1 of 1, from 203 to 270: score 68.6, E = 4.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+LHD+ g Ls+i++++el+++l+ ++ +++a e+ +e+
CP001643_0 203 ERLRFARDLHDVTGRDLSVIAVKSELVAQLA--ERQDPRAVEHGREV 247

relarealaevRrllgdLRpaal<-*
+++ar++lae+R l++++R+a+l
CP001643_0 248 AQIARTSLAEIRSLVRGYREADL 270

CP001643_1221: domain 1 of 1, from 229 to 296: score 64.6, E = 7e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI R+LHD+v +L +++ l+ ar+++ ++dp++a+ ++e+
CP001643_1 229 ERLRIERDLHDGVQPRLVNLAMTLGIARQAI--RADPDRAEHLVAEA 273

relarealaevRrllgdLRpaal<-*
++ a+ ++++R+l+++++pa+l
CP001643_1 274 HGEAKAVMTDLRQLARGIHPAVL 296

CP001643_1764: domain 1 of 1, from 173 to 246: score 51.8, E = 4.2e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrllds...dkdpeeareal
ER RIAR+LHD Q L+a+ + le++ l+ ++ + ++++r +
CP001643_1 173 ERGRIARDLHDLAIQELFAVGMELEALVDSLEApgmTPSNARIRSSV 219

deirelarealaevRrllgdLR.paal<-*
++ + ++ a a++R++++ LR++ ++
CP001643_1 220 ATSVQGVENAVAQIRQIVQSLRrERTE 246

CP001643_0026: domain 1 of 1, from 214 to 277: score 51.3, E = 5.9e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A++LHD+++Q+L +i l++ +ar +++p ea +++ +i
CP001643_0 214 ERQRLAQDLHDTLAQGLNSIVLMSRAAR-----TAHP-EAGAEFSRI 254

relarealaevRrllgdLRpaal<-*
+++ar la++R l++dL a
CP001643_0 255 EDAARSNLADARGLVRDLAARAP 277

CP001643_0562: domain 1 of 1, from 195 to 260: score 48.1, E = 5.2e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IA +LHD+++ +Lsa++l+++la+ +dp++ ++ l+++
CP001643_0 195 ERRTIAHDLHDVIAGHLSAVSLHTGLAAS----LEDPAARDRSLTTA 237

relarealaevRrllgdLRpaal<-*
r+ a+ al+++R ++g+L a+
CP001643_0 238 RDCAHAALRDLRSMIGVLSSAEA 260

CP001643_1147: domain 1 of 1, from 258 to 325: score 41.8, E = 3.8e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+R+ R+LHD+ Q+L +++ l ++++l+ kdpe+a++ l+e
CP001643_1 258 ALRRLERDLHDGPQQRLVRASMDLARVEALA--VKDPEKAQAVLRET 302

relarealaevRrllgdLRpaal<-*
re + +l+++Rrl +++ p++l
CP001643_1 303 REQLGLTLDDLRRLSRGIAPPIL 325


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 3 0|=
-13 20 0|===
-12 38 34|====*
-11 91 281|============ *
-10 214 652|=========================== *
-9 411 740|==================================================== *
-8 408 571|=================================================== *
-7 450 359|============================================*============
-6 428 203|=========================*============================
-5 382 108|=============*==================================
-4 229 56|======*======================
-3 146 29|===*===============
-2 96 14|=*==========
-1 59 7|*=======
0 35 3|*====
1 15 1|*=
2 6 0|=
3 15 0|==
4 4 0|=
5 4 0|=
6 1 0|=
7 0 0|
8 0 0|
9 1 0|=
> 10 12 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3345.8689
P(chi-square) = 0

Total sequences searched: 3068

Whole sequence top hits:
tophits_s report:
Total hits: 11
Satisfying E cutoff: 11
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 11
Satisfying E cutoff: 11
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: