Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

5 accessions found for Ralstonia pickettii 12D  

Data for CP001644  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001644.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001644_3356 CDS_3594869-3596335 65.7 3.9e-19 1
CP001644_0147 CDS_158738-160195 64.9 6.7e-19 1
CP001644_3032 CDS_3252871-3254007 59.2 3.2e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001644_3356 1/1 263 336 .. 1 70 [] 65.7 3.9e-19
CP001644_0147 1/1 252 319 .. 1 70 [] 64.9 6.7e-19
CP001644_3032 1/1 163 233 .. 1 70 [] 59.2 3.2e-17

Alignments of top-scoring domains:
CP001644_3356: domain 1 of 1, from 263 to 336: score 65.7, E = 3.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpe...earea
ERaR +RELHD+++Q L + kl le+a+ +l+ +++ p++ ++a
CP001644_3 263 ERARVSRELHDGISQVLVSTKLLLETAHGHLEAsAASPAsieRAGSM 309

ldeirelarealaevRrllgdLRpaal<-*
l+++ + ++ al evRr+ ++LRpa l
CP001644_3 310 LRRALDRLNGALGEVRRVSHNLRPALL 336

CP001644_0147: domain 1 of 1, from 252 to 319: score 64.9, E = 6.7e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +R+ARELHD++g L+a k+ l+++r ++ ++ +++ e ++++
CP001644_0 252 EKTRLARELHDELGAILTATKMDLHWLRSRV--HSSEPAVSEKITRV 296

relarealaevRrllgdLRpaal<-*
+++++++++ Rrl+ dLRp++l
CP001644_0 297 MAHVDQGIQIKRRLIEDLRPTIL 319

CP001644_3032: domain 1 of 1, from 163 to 233: score 59.2, E = 3.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
E +RIARELHD +gQ+L+a+k+ + ++++ + pe are+
CP001644_3 163 EKKRIARELHDDLGQQLTALKMIITGLLADD--STTPEalaYARERT 207

deirelarealaevRrllgdLRpaal<-*
++ +++++ala vRrl+ +LRp+ l
CP001644_3 208 LAMSHAIDHALASVRRLAAGLRPTML 233


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 8 0|=
-13 41 0|=====
-12 82 38|===*=====
-11 152 312|================ *
-10 419 725|========================================== *
-9 589 823|==========================================================*
-8 493 634|================================================== *
-7 471 399|=======================================*========
-6 377 225|======================*===============
-5 326 121|============*====================
-4 169 63|======*==========
-3 101 32|===*=======
-2 74 16|=*======
-1 39 8|*===
0 25 4|*==
1 14 2|*=
2 10 1|*
3 7 0|=
4 6 0|=
5 2 0|=
6 0 0|
7 0 0|
8 1 0|=
9 0 0|
10 1 0|=
11 0 0|
12 0 0|
> 13 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1450.6793
P(chi-square) = 0

Total sequences searched: 3411

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: